KEGG   Xanthomonas campestris pv. vesicatoria: XCV0886Help
Entry
XCV0886           CDS       T00288                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XCV0886
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XCV0886
   3.1.2  Thioester hydrolases
    3.1.2.-  
     XCV0886
Lipid biosynthesis proteins [BR:xcv01004]
 Fatty acid synthase
  Component type
   XCV0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017239..1017907
Genome map
AA seq 222 aa AA seqDB search
MRNLRMRERTLRYGVLALWLLTLSLLAPGIASARSPVATAPVLVVGDSLSAAHNIPVQSG
WVTLLDQRLKRDMATPPAVVNASISGETTSGALTRLPGLLEKHRPGVVVIELGGNDALRG
LTPAQLKGNLEKMIQLSQHAGAKVLLLGIDVPPNYGPAYRERLKATYADLSTQYKTALVP
FFLEKVALQPGLMQADGLHPTAAAQPKVLETVWPALRPLLGR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccgaatgcgtgaaagaacactgcgatatggcgtgctggccctgtggctg
ctgacactctccctgcttgcgccggggattgcctctgccagaagtccggtcgccactgcg
ccggtcctggtggtgggcgacagcctgagcgctgcgcacaacatcccggtgcagtccggc
tgggtgaccttgctggaccagcgcctgaagcgtgacatggcgacgccaccggcagtcgtc
aatgccagcatcagcggcgaaaccacctccggcgcgctgacccggctgccgggcctgctg
gaaaaacaccgccccggcgtggtggtcatcgagctcggcggcaacgacgcgctgcgcggg
ctgaccccggcccagctcaagggcaacctggaaaagatgatccagctcagccagcacgcc
ggcgccaaggtgctgctgctcgggatcgacgtgccgcccaattacggcccagcctaccgc
gagcggctcaaggcgacctatgcggacctctccacacagtacaagaccgcgctggtgccg
ttcttcctggaaaaggtcgcgctgcagcccggcctgatgcaggcggacggtctgcacccc
accgccgccgcgcaaccgaaggtgctggagacggtatggccggcattgcgcccgctgctc
ggccgctaa

DBGET integrated database retrieval system