KEGG   Xanthomonas campestris pv. vesicatoria: XCV1129Help
Entry
XCV1129           CDS       T00288                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCV1129 (recR)
DNA repair and recombination proteins [BR:xcv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XCV1129 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260038..1260631
Genome map
AA seq 197 aa AA seqDB search
MSTLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALGNAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFILQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttgctcgaacaactgatcgaggccttccgggtattgcccggcgtgggccag
aagtcggcccagcgcatggcctatcacgtgctcgagcgcgagcgcgagggcgggcggcgg
ctggccgctgcgttgggcaacgcggtggaaaaggtggggcattgcgtgcaatgccgcgac
ttcaccgaatcggaaatctgcaccatttgcgccagcagcagccgcgaccggcagcagcta
tgcgtggtggagtcgccggccgatcgcctggcgatcgaacatgccaccggctaccgcggg
ctgtatttcattctgcaggggcgcctgtcgccgctggatggcatcggcccgcgcgaactg
gggctggatcggctcggcgagcgtctggctgccggcgaagtgaccgaaatgatcatcgcc
accaatgcgacggtcgaaggcgaagccacggcccattacctggcgcaactggcgcgccag
cacgcagtacgcccaagtcggctcgcccagggcatgccgctgggtggcgagctggagtat
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctttga

DBGET integrated database retrieval system