KEGG   Xanthomonas campestris pv. vesicatoria: XCV1129Help
Entry
XCV1129           CDS       T00288                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xcv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260038..1260631
Genome map
AA seq 197 aa AA seqDB search
MSTLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALGNAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFILQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttgctcgaacaactgatcgaggccttccgggtattgcccggcgtgggccag
aagtcggcccagcgcatggcctatcacgtgctcgagcgcgagcgcgagggcgggcggcgg
ctggccgctgcgttgggcaacgcggtggaaaaggtggggcattgcgtgcaatgccgcgac
ttcaccgaatcggaaatctgcaccatttgcgccagcagcagccgcgaccggcagcagcta
tgcgtggtggagtcgccggccgatcgcctggcgatcgaacatgccaccggctaccgcggg
ctgtatttcattctgcaggggcgcctgtcgccgctggatggcatcggcccgcgcgaactg
gggctggatcggctcggcgagcgtctggctgccggcgaagtgaccgaaatgatcatcgcc
accaatgcgacggtcgaaggcgaagccacggcccattacctggcgcaactggcgcgccag
cacgcagtacgcccaagtcggctcgcccagggcatgccgctgggtggcgagctggagtat
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctttga

DBGET integrated database retrieval system