KEGG   Xanthomonas campestris pv. vesicatoria: XCV1369Help
Entry
XCV1369           CDS       T00288                                 

Gene name
fadB
Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV1369 (fadB)
   01212 Fatty acid metabolism
    XCV1369 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XCV1369 (fadB)
   00650 Butanoate metabolism
    XCV1369 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XCV1369 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XCV1369 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCV1369 (fadB)
   00310 Lysine degradation
    XCV1369 (fadB)
   00380 Tryptophan metabolism
    XCV1369 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XCV1369 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XCV1369 (fadB)
   00281 Geraniol degradation
    XCV1369 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XCV1369 (fadB)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XCV1369 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XCV1369 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XCV1369 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1547735..1549816)
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQADLREDGVVVLSLDRQGAPVNAFSQEVLLELGAVVERLALDPPKGV
VLRSGKPNGFIAGADLKEFQEFDRKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLTGRTVS
AKAARAMGLVDKVAAPAVLVDVAASLALAGTARAFKQRATAWATNTLLARKLLAPQMRKQ
VARKARKEHYPAPYALINVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAAAPIRHVHVIGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDTALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQSIEPQLKP
DALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAF
CKALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLRLPIPAALATVEAGKRGKKDGQGLYKWENGRAVKPEVASGY
TAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQYIRSVGAD
ALLERLHALHARYGERFAPRPGWDSPLLREAVA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgatctgcgcgaggac
ggcgtggtggtgctcagcctcgatcggcagggcgcaccggtcaacgcattttcgcaggag
gtgctgctggagctgggcgccgtggtcgagcggctggcactggatccgccaaagggcgtg
gtgctgcgctcgggcaagcccaacggcttcatcgccggcgccgatctgaaggaattccag
gaattcgatcgcaagggtacggtcaacgatgccatccaccgcgggcagcaggtcttccag
aagctggccgaactgccctgcccgaccgtcgcggcgattcatggcttctgcatgggcggc
ggtaccgaaatcgcgctggcctgccgctaccgcgtggcctccgatgacggcagcacccgc
atcgggctgccggagaccaagctgggcatctttcccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggccgcgatggatctgatgctcaccggccgcacggtatcg
gccaaggctgcgcgcgcgatggggctggtcgacaaggtcgccgcgcctgccgtgctggtg
gatgtggcagccagcctggcgctcgccggcaccgcgcgtgcgttcaagcagcgcgccact
gcgtgggccaccaataccttgctcgcgcgcaaactactggcgccgcagatgcgcaagcag
gtggcgcgcaaggcgcgcaaggagcattacccggcgccctacgccctgatcaacgtctgg
gagcgggcgggcggcagcggcatccaggcgcgcctggcggccgagcgcaaggcggtggtc
aaacttgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgc
ctgaaagcgctgggcggcaaggacgcagccggtgcggcggcggccccgattcgccatgtg
catgtgatcggcgccggcgtcatgggcggcgacatcgcggcgtgggcggcttacaagggc
ttcgaggtcacgttgcaggaccgcgagcagcgttttatcgatacggcgctgacgcgcggc
ggcgaactgttcgccaagcgcgtcaaggacgacgccaagcggccggccgtggccgcgcgc
ctgcgcggcgatctggccggtgcgggtgtgacgcaggccgatctggtgatcgaggcgatc
atcgaaaacccgcaggcaaagcgcgatctgtaccaatcgatcgagccgcaactcaagccg
gatgccttgctgacgaccaatacctcgtcgattccgctgaccgaattgcgtggccacatc
cagcgcccggcgcaatttgccggcctgcactacttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggtctggatccggccaacgtcgcgcgcctggctgcgttc
tgcaaggccttggacaagttcccggtgccggtggccggcacgccgggattcctggtcaac
cgggtgctgttcccctacctgctcgaggcggccaccgcgtatgccgaaggcattcctggc
ccggtgctggacaagacggcggtgaagttcggcatgccgatggggccgatcgaactgatc
gacaccgtgggcctggatgtggcggcgggcgtgggcgcggagctggcgccgttcctgcgt
ttgcccatcccggcggcactggcgaccgtggaagccggcaagcgcggcaagaaggacggc
cagggcctgtacaagtgggagaacggacgcgccgtcaaacccgaggttgccagcggctac
accgcaccggcggatttggaagaccgcctgatcctgccgctgctcaacgaagcggtggcc
tgcctgcacgatggcgtggtggccgacgcagacctgctggacgccggagtcatcttcggc
acaggtttcgcacctttccgtggcggcccgatccagtacatccgcagcgtcggcgcagac
gcgctgctggagcgcctgcacgcgctgcatgcacgctatggcgaacgcttcgcgccgcgc
ccgggttgggactcgccgttgttgcgggaagcagtggcttga

DBGET integrated database retrieval system