KEGG   Xanthomonas campestris pv. vesicatoria: XCV1386Help
Entry
XCV1386           CDS       T00288                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XCV1386
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XCV1386
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XCV1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566687..1567772
Genome map
AA seq 361 aa AA seqDB search
MRDLTLPRASATMPRCATVAPGPGVPNMLLIGVAGTELSAQERDWLQHDAVAGVVLFKRN
FASRTQVAELSAAIRAAAPRPVLVCVDQEGGRVQRFREGFSALAPLQSFGAQYAHDPESA
LAAARAHAQLMASEVRASGVDLSFAPVVDLGRGNRAIGDRAFSDDPQIVATFTRAYVQAL
HGAGMAATLKHFPGHGTVLEDTHVDHASDPRPLEVLQAEDLVPFVAGIEAGADAVMMAHV
VYPQVAPEPAGYSQRWIEQILRGQMGFCGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCD
VVLVCHPELVAESLQAVQGRSLNTAALIGLIGRGALGWDGLLAGTDASFTTPPSAHFGTT
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatctgacgctgccacgcgcatctgcgacaatgccgcgctgcgccaccgtggcg
cctggcccgggagtccccaacatgcttctgatcggcgttgccggtaccgaactcagcgcg
caggaacgcgattggctgcagcacgatgcggttgccggcgtggtgctgttcaagcgcaac
ttcgcctcgcgcacccaggtggccgagctgtcggctgccattcgcgccgccgcgccacgc
ccggtgctggtctgcgtggaccaggaaggcgggcgcgtgcagcggtttcgcgaaggattc
agcgcgctggcgccgctgcaaagcttcggtgcgcagtacgcgcatgacccggagtctgca
ctggccgccgcgcgcgcgcatgcgcagttgatggccagcgaggtccgcgccagcggcgtg
gacctgagctttgccccggtggtggacctggggcgcggcaaccgcgccatcggcgatcgc
gccttcagcgacgacccgcagatcgtggccaccttcacgcgtgcttatgtgcaggcgctg
cacggcgccggcatggccgccacgctcaagcattttcccggccacggcaccgtgctggaa
gacacccatgtcgaccacgccagcgacccgcggccgctggaggtgctgcaggccgaagac
ctggtgccgttcgtggcggggatcgaggccggcgccgacgccgtgatgatggcgcacgtg
gtctacccgcaggtcgcgccggagccggccggctattcgcagcgctggatcgagcagatc
ctgcgcggccagatgggcttctgcggcgtggtcttttccgacgacatcggcatggctgcc
tcgttcagtgccggcggtgtggcgggccgggtgcatgcgcatctggatgccggctgcgac
gtggtgctggtgtgccatccggagctggtcgccgaatcgctgcaggccgtgcagggccgc
agcctcaataccgctgcattgatcggcctgatcggccgcggcgcactaggctgggatggc
ctgctcgccggcaccgacgcctcatttaccactcctccttctgcccatttcggaacaact
gcctga

DBGET integrated database retrieval system