KEGG   Xanthomonas campestris pv. vesicatoria: XCV1434Help
Entry
XCV1434           CDS       T00288                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XCV1434
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XCV1434
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XCV1434
Lipid biosynthesis proteins [BR:xcv01004]
 Desaturase
  First
   XCV1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1613021..1614154)
Genome map
AA seq 377 aa AA seqDB search
MCAQLRDSFATPSEPHPCVRRSSGLVHLFAGSVRTGSRLLYGESRVPSTGLDPHAAAPQP
ATAPPRGGLAARVGSLRRWVDSQTDEPLDEARADRIDWLRAVPFIALHLACLAVFWVGAS
WFAVGMAVALYALRMFALTGFYHRYFSHRAFKTSRVLQFVFAAIGATCVQRGPLWWAAHH
RNHHRHTDTGRDPHSPAQHGFWWSHTGWFLTPRNFRTDWEVIPDLRRFAELRFLDRFDIV
MPVLLALGLYLLGDWLAVAAPALKTSGAQLLVWGFVISTVALFHATFTINSLAHRFGSRR
FDTRDDSRNNWLLALLTFGEGWHNNHHFFPGSARQGLRWWEYDMTWYGLTAMSWVGLVWD
LKPMPKLLTQRAERVKR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgcagctgcgcgattcgttcgcgacgccaagcgaaccccacccatgcgtgcga
cgatcaagcggcctggtgcatctgtttgccggcagcgtccgtactgggtcacgactactc
tatggagaatcacgcgtgccgagcactggcctcgaccctcacgccgcagcgccgcagccc
gccaccgcaccaccgcgtggcgggctggccgcacgcgtcggcagcctgcggcgctgggtg
gattcgcaaaccgacgagcccctggacgaagcgcgtgccgatcgcatcgactggctacgt
gcggtgcctttcatcgccttgcacctggcctgcctggcggtgttctgggtcggtgcgtcc
tggtttgcggtgggcatggcggtggcgttgtacgcgctgcgcatgttcgcgctcaccggt
ttttaccaccgctacttctcgcaccgcgcgttcaagacgtcgcgggtgctgcaattcgtg
ttcgccgccatcggggccacctgcgtgcagcgcgggcctttgtggtgggcggcgcatcat
cgcaaccaccatcgacataccgacaccggccgcgatccgcattcgccggcgcagcacggc
ttctggtggagccataccggctggttcctgaccccgcgtaatttccgcaccgactgggaa
gtgattcccgacctgcgccgctttgccgaactgcgttttctggaccgcttcgacatcgtg
atgccggtgctgctggcgctgggcctgtacctgctcggcgactggctggcagtggctgcg
cccgcgctgaaaaccagcggcgcgcagttgttggtgtggggctttgtgatctccaccgtg
gcgttgttccatgccaccttcaccatcaactcgctggcgcatcgtttcggcagccggcgg
ttcgacacccgcgacgacagccgcaacaactggctgctggcattgctcaccttcggcgaa
ggctggcacaacaatcaccatttcttcccaggctcggcgcgccagggattgcgatggtgg
gaatacgacatgacctggtacggactcaccgcgatgtcgtgggtggggctggtgtgggac
ctcaagccgatgccgaagctgctcacccagcgcgccgaacgggtgaagcgatga

DBGET integrated database retrieval system