KEGG   Xanthomonas campestris pv. vesicatoria: XCV1472Help
Entry
XCV1472           CDS       T00288                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00900  Terpenoid backbone biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCV1472 (dxr)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XCV1472 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CAJ23103
UniProt: Q3BVL0
Position
complement(1654940..1656130)
Genome map
AA seq 396 aa AA seqDB search
MAGSSLRQVAVFGATGSIGASALDVIARHPERLRASLLSAGSKVDELLALCATHRPAHAV
IADAALYPALRDGLRALGLATQAHAGAEALDALASGDVCDTVVAAIVGAAGLPSTLAAAR
AGKRLLLANKESLVLAGELLTRTAAAAGAEIIPIDSEHSAIFQCLRSCDASRGVRRVILT
ASGGPFRGRDRAALAAVTPAQAVAHPKWSMGPKISVDSATMMNKGLEVIEAHHLFGLPGE
QIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVDSGVGGLDLLRQGR
LDFEAPDTAAFPCLRLAWDALRAGGTAPAILNAANEVAVSAFLQGQVGFLAIPALVEHTL
TTLPRHNADSLDTLLFADAQARQITERALAHHALHA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcctctctccgtcaggtcgccgtgttcggcgccaccggctcgatcggtgca
tcggcactggacgtgatcgcgcgtcaccccgagcggctgcgcgccagcctgctgtcggcc
ggcagcaaggtcgatgagctgctggcgctgtgcgccacccaccggcctgcgcatgcggtg
attgccgatgcagcgctgtatcccgcgctgcgcgatggcctgcgcgcgctgggcctggcg
acccaggcgcacgccggcgccgaggcgttggacgcactggcgagcggcgatgtgtgcgac
accgtggtggcggcgatcgtgggtgcggccgggctgccgtctacgctggcggcagcgcgc
gccggcaagcgtctgttgctggccaacaaggaatcgctggtgctggctggcgagctgctg
acccgcaccgcagccgctgccggcgctgaaatcattccgatcgacagcgaacacagcgcc
atcttccagtgcctgcgctcctgcgacgccagccgcggcgtgcgccgggtcatcctgact
gcctccggtggcccgttccgcggccgcgaccgcgcggcacttgccgcagtcacgcccgcg
caggcagtggcgcatcccaagtggtcgatgggcccgaagatctcggtggattcggcaacc
atgatgaacaagggcctggaagtcatcgaggcgcatcacctgttcggactgccgggcgag
cagatcgatgtgctggtgcatccgcagagcctggtgcattcgctggtggaattcgtcgac
ggctccacgcttgcccagcttggcctgccggacatgcgtaccaccctggcggtgggcttg
gcctggccggagcgggtcgactccggcgtcggcgggctggacctgcttcgccagggccgg
ctggatttcgaggcccccgacaccgccgcgttcccatgtctgcgcctggcctgggacgcg
ttacgggccggcggcaccgccccggcgatcctgaacgcggccaatgaagtggctgtttca
gcctttcttcagggccaggtgggtttcctagcgatccctgcgttggtcgaacacacactg
acaacgctcccgcggcacaatgccgactccctcgacaccctgctttttgccgatgcgcaa
gcccggcaaatcactgaacgcgccctcgcccaccacgcccttcatgcctga

DBGET integrated database retrieval system