KEGG   Xanthomonas campestris pv. vesicatoria: XCV1489Help
Entry
XCV1489           CDS       T00288                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00300  Lysine biosynthesis
xcv01100  Metabolic pathways
xcv01120  Microbial metabolism in diverse environments
xcv01230  Biosynthesis of amino acids
Module
xcv_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    XCV1489 (dapE)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     XCV1489 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: CAJ23120
UniProt: Q3BVJ3
Position
1674868..1675998
Genome map
AA seq 376 aa AA seqDB search
MSDVLELTCDLIARASVTPADAGCQAAIAQRLRAAGFGCEHLRLGEVENLWATHGSGAPV
LVLLGHTDVVPPGPREAWTSDPFDPQIRDGVLYGRGAADMKGSVAAFVVAAEQFVAAHPT
HSGTLAVLLTSDEEGDAIDGVRRVAEVFRERGQTIDWCITGEPSSTERLGDLLRVGRRGS
LSGTLTVKGVQGHVAYPHKARNPIHLAAPALAELVARQWDDGFESFPPTSLQLSNIHAGT
GANNVIPGELQVAFNLRYTPHWDAPRLEAEITALLDRHALDYTLRWHRSGEPFYTPEGRL
RSVAREVLGEFAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDEHVRVADLQ
ALPALYRTLIERLLVE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtgctggagttgacctgtgacctcattgcacgtgcctcggtaacgccggca
gatgccggttgccaggccgcgattgcgcagcgcctgcgcgcagccggcttcggctgcgag
cacttgcgccttggcgaggtcgagaatctgtgggcaacccatggcagcggtgcgccggtg
ctggtgttgctcgggcataccgatgtggtgccgccgggcccgcgcgaggcgtggaccagc
gacccgttcgatccgcagatccgcgacggcgtgttgtatgggcgtggtgcagcggacatg
aaaggcagcgtggccgccttcgtggtcgccgcagagcaattcgtcgctgcacacccaacg
cactccggcacgctggcggtgctgttgacctcggacgaagagggcgatgccatcgatggc
gtgcgccgggttgccgaggtgtttcgcgaacgcgggcaaacgatcgactggtgcatcacc
ggcgaaccgtcgtccaccgagcgcctgggcgatctgttgcgcgtgggccgtcgcggcagc
ctgtccggcacgttgaccgtgaagggtgtgcaggggcatgtggcgtatccgcacaaggcg
cgcaaccccatccatctggcagcgcctgcgctggccgaactggtggcgcggcaatgggac
gacggcttcgaaagctttccgcccaccagcctgcaactttccaacatccacgccggcacc
ggcgccaataacgtgattcctggcgagctgcaggtggccttcaatctgcgctatacgccg
cactgggacgcgccgcgcctggaagccgaaatcaccgcgctgctcgatcggcatgcgctg
gactacacgctgcgctggcaccgcagcggcgagccgttctataccccggaagggcggttg
cgcagcgtcgcgcgtgaggtcctgggggagttcgccggtgcgccgccggaagaaagcacc
gggggcggcacctccgacgcgcggttcattgcgccactgggtgcgcaatgcatcgaagtg
ggcccggtcaatgccagcatccaccaggtcgacgagcatgtgcgcgtcgccgacctgcag
gcgctaccggcgctgtaccgcacgttgatcgagcgcctgctggtcgagtga

DBGET integrated database retrieval system