KEGG   Xanthomonas campestris pv. vesicatoria: XCV1533Help
Entry
XCV1533           CDS       T00288                                 

Gene name
asnB2
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xcv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1727382..1729322
Genome map
AA seq 646 aa AA seqDB search
MCGLAGMLLASPRLHGEQLDALVRPMGAALRHRGPDDAGTWCDAQAGVALAHQRLSILDL
SPLGHQPMRSADGRYVLAYNGEVYNFAQLRAALSALGHRFRGHSDTEVLLAAVVEWGLDE
TLTRCNGMFAIALWDERDNCLFLARDRVGKKPLYYGWAGDTLVFGSELKALWQHPDFDNG
VDRDALTLLLRLGYIPAPACIHEHTFKLMPGRVLRMDAQAVAAGAAAHRPDQAQQPFWNA
REAMQRALATPFTGTDAQAEEQLDSVLRDAVALRMVADVPVGVFLSGGTDSSIVTAMMQA
QSAQPVHTFSIGFEGSHHDEAPLAREVATHLRTDHTELYVSGADALAVVPGLPDMFDEPF
ADASQVPTALVARLARGGVTVALSGDGGDELFFGYGRYQRALRNWRMHGLVPGPLRRLMA
VAARRNGESSRTGGLAALVAEAGARGIGDIYRNRISRWRDPAAVVLGATEPDSFYSLADP
LHGSGTPADAMMLADFAAYLPDDLLCKVDRTTMAVGLEARAPLLDWRVAEFAWSLPLSLK
YRDGVSKYLLKRVLCRYLPDAMVYRGKRGFGAPVSAWLRGDLHGWADDLLAHGALQREGV
FAADSVARLWRDFNGGERKWHTHLWTVLMFQAWQAHWREQRAAVVR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattggcaggaatgttgctggcctcgccgcgcctgcatggcgaacagctcgat
gcgctggtgcggccgatgggggccgccttgcgccaccgcggccccgacgatgccggcacc
tggtgcgatgcacaggccggcgtagcgctggcgcatcagcgcttgagcattctggacctg
tcgccgctcggccatcagccgatgcgctcggcagacggccgctacgtgctggcctacaac
ggcgaggtctataacttcgcgcagttgcgcgcagcgctgtccgcgcttgggcatcgcttc
cgcggccactccgataccgaagtgctgctggcggccgtggtggagtggggcctggacgag
acgttgacccgctgcaacggcatgttcgccattgcgttgtgggacgagcgcgacaactgc
ctgttcctggcccgcgaccgcgtcggcaagaagccgctgtactacgggtgggccggcgac
accttggtgttcggttccgaactcaaggccttgtggcagcatccggatttcgacaacggc
gtggatcgcgatgcgctcacgctgctgctgcggctgggctatatcccggcgccggcctgc
atccacgagcacaccttcaagctgatgcccggccgcgtgctgcgcatggatgcacaagcc
gttgcagccggcgcggccgcgcatcgtcccgatcaggcgcagcaaccgttctggaacgcc
cgcgaggcgatgcagcgcgcgctggcgacgccgttcaccggtaccgacgcgcaggccgaa
gagcagttggatagcgtactgcgcgatgcggtggccttgcgcatggtggccgatgtgccg
gtgggcgtgtttctctccggcggcaccgactcgtccatcgtcactgcgatgatgcaggca
caaagcgcgcagccggtgcacaccttcagcatcggcttcgaaggttcgcatcacgacgaa
gcgccgctggcgcgcgaagtggccacgcatctgcgcaccgaccacaccgaactgtatgtc
agcggcgccgatgcgctggcagtggtgccgggcctgccggacatgttcgacgaacccttc
gccgatgcctcgcaagtgccgacggcgttggtcgcacggctggcgcgcggcggggtcacg
gtggcgctgtcaggcgatggtggcgacgaattgttcttcggctatggacggtatcagcgc
gcactgcgcaattggcgcatgcatggcctggtgccgggcccgctgcgtcgcctgatggcg
gtggcagcgcgtcgcaatggcgaatcttcgcgcactggcggcctggccgcgctggtggcc
gaggccggtgcacgtggcatcggcgacatctaccgcaaccgcatttcgcgctggcgcgat
ccggccgcggtggtgctcggtgccaccgagcccgacagtttctacagcctggccgacccg
ctgcatgggtccggcaccccggccgatgcgatgatgctggccgattttgccgcctacctg
ccggacgatctgctgtgcaaggtggaccgcaccaccatggcggtggggctggaagcgcgc
gcgccgctgctggactggcgcgtggccgaattcgcgtggtcgctgccgctgtcgctgaaa
tatcgcgatggagtgagcaagtatctgctcaagcgcgtgctgtgccgctacctgccggac
gcaatggtgtaccgcggcaagcgcggcttcggcgccccggtcagcgcatggctgcgtggc
gacctgcacggctgggcggacgatctgctggcgcacggcgccctgcagcgcgaaggcgtg
ttcgccgccgacagcgtggcccgcctgtggcgcgacttcaacggtggcgagcgcaaatgg
catacgcatctatggacggtgctgatgttccaggcatggcaggcacactggcgcgaacag
cgtgcggccgtggtgcgctga

DBGET integrated database retrieval system