KEGG   Xanthomonas campestris pv. vesicatoria: XCV1720Help
Entry
XCV1720           CDS       T00288                                 

Definition
cytochrome C precursor
Orthology
K08738  
cytochrome c
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xcv00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1938968..1939360)
Genome map
AA seq 130 aa AA seqDB search
MNPPRKLSVLCAPLAGLMLAGALTMPSAYAADGAGVFLTECGECHSVKPGKNKKGPSLFG
VAGRPAGTVADFGGYSDALKNSKWTWTPAQLKTYLSQSSSKALPGTKMKYDGLDDPKELD
ALIAYLNTLK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaccacgcaaactctccgtgttgtgcgccccgttggccggcctgatgctggcg
ggcgcactgaccatgccctcggcctacgctgccgacggcgccggcgtcttcctcaccgaa
tgcggtgaatgccacagcgtcaaaccgggcaagaacaagaaaggtccgtcgctgttcggc
gtggcaggccgccctgccggtaccgtcgcagacttcggcggttattccgatgcgctcaag
aacagcaagtggacctggactccggcccagctcaagacctatctgtcgcaatcctcgtcc
aaggcgctgccgggcaccaagatgaagtacgacggcctggacgacccgaaggagctcgac
gcactgatcgcctacctcaacactttgaagtag

DBGET integrated database retrieval system