KEGG   Xanthomonas campestris pv. vesicatoria: XCV1759Help
Entry
XCV1759           CDS       T00288                                 

Definition
L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XCV1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981130..1981807
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIQDEATLNAMRTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPAKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWPEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGPSSQSLVQLTRGADGAIEQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcgggatcggcatgacctcgcaacgc
gtgcgcgaccgcctggtcgagcgcttgcgcgaggcgggcatccaggacgaggccacgctc
aacgcgatgcgcaccgtgccgcggcatctgttcatcgatgaagcgctggcctcgcgcgcc
tacgaagacactgcgctgccgatcggccatggccagaccatctcccagccctgggtggtg
gcgcgcatgaccgaagcggtgctgcaggtgaccccggccaaggtactcgaagtgggcacc
ggctccggctaccagggcgcgatcctggcggcgctggggctggaggtctacaccgtcgag
cgcatcggcgacctgctgcggcaggcgcgcaagcgcttccggcacctgggcatgaatgtg
cgcagcaagcacgacgacggccgcatcggctggcccgaacacgggccgtacgacgccatc
gtggtgaccgctgccgcaccggcgttggtcgatgcattggtcgaccagctggcggtcggc
gggcgcctggtcgcgccggtcggagggccttcctcgcaatcgttggtgcaactcacccgc
ggggccgatggcgccatcgaacaacaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system