KEGG   Xanthomonas campestris pv. vesicatoria: XCV1766Help
Entry
XCV1766           CDS       T00288                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00790  Folate biosynthesis
xcv01100  Metabolic pathways
Module
xcv_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XCV1766 (folP)
Enzymes [BR:xcv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XCV1766 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CAJ23443
UniProt: Q3BUR6
Position
1986928..1987830
Genome map
AA seq 300 aa AA seqDB search
MFDTTLTLDCAGRSLRLDAPQVMGIVNVTPDSFSDGGQHATCEAAIAHGLALVEQGAAVL
DVGGESTRPGAAAVSVEEELQRVIPVIEALAQRTSVPISVDTFKPEVMRAAVAAGAGMVN
DVYALRSPGALEAASDLCVPVVLMHARSAPHAMQDAPHYDDIVGEVHRFLAERIFAAEMA
GIDKRRLVLDPGFGFDKATPHNLTLLAQLQRLQEFGLPVLAGLSRKRSIGELTGRQIAAE
RVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWTAMAAIPVPRVSAPAAPTIRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataccaccctcacactggattgcgccggccgcagcctgcgactggatgcaccg
caggtgatgggtatcgtcaatgtcacacccgattcgttctccgacggcggccagcatgcg
acctgcgaagcggcgatcgcgcatgggctggcgttggtggagcagggcgccgcggtgctg
gatgtcggtggtgaatccacccgcccgggcgctgcggcggtctcggttgaagaagaattg
cagcgggtcattccggtgatcgaggcgctggcccagcgcacgagcgtgccgatcagcgtg
gatacgttcaaaccggaggtcatgcgcgcggcggtcgcggccggcgccggcatggtcaac
gacgtctatgctctgcgttcgcccggtgcgctggaagcggcgtcggacctgtgcgtgcct
gtggtcttgatgcatgcgcgcagcgcgccacacgccatgcaggatgcgccgcactacgac
gatatcgtgggtgaagtgcaccggtttctggccgaacgcatcttcgctgccgagatggcc
ggcatcgacaagcgccggctggtcctggacccgggctttggcttcgataaggccaccccg
cacaacctcaccctgcttgcgcagctgcagcggctgcaggaattcggtttgccggtgctg
gccgggctgtcgcgcaaacgcagcatcggcgaactgaccgggcgccagatcgccgccgaa
cgtgtgcacggctcggtggccgcgcatctgatcgccgcacaacatggcgcgctgctgctg
cgcgtgcacgatgtggcggcaaccgtggatgcgttgaaggtatggacggcgatggcggcg
attccggtaccgcgtgtcagcgcgcccgccgcgcccacgatccgttggccggatgaggac
tga

DBGET integrated database retrieval system