KEGG   Xanthomonas campestris pv. vesicatoria: XCV1808Help
Entry
XCV1808           CDS       T00288                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCV1808
   00051 Fructose and mannose metabolism
    XCV1808
Enzymes [BR:xcv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XCV1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2038451..2039788
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDAGTTALNRAEAKADAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYEKNLKHMVGIAKQRQADTGIKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDSGAGADFAAGKTTLADLAKHA
ASNAPQQLSGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtgtacatcggcgcgaaagaatatttccccggcatcggcaagatcggc
ttcgaaggccgcgattcggacaacccgctcgcgttcaaggtctacgacgccaacaaaacc
atcggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgacccgttcggcccgggcacgcgggcgtatccgtgggatgcgggc
actaccgcgttgaaccgtgccgaagccaaggccgatgcggcgttcgagttcttcaccaag
ctcggcgtgccgtactactgcttccacgatatcgacctggcaccggatgccgacgacatc
ggcgagtacgaaaagaatctcaaacacatggtgggcatcgccaagcagcgccaggccgac
accggcatcaagctgttgtggggcacggccaacctgttctcgcacccgcgctacatgaat
ggcgcatcgaccaacccggacttcaatgtcgtggcgcgcgccgccgtgcaggtcaaggcc
gcgatcgatgccaccgttgaattgggcggcgaaaactacgtgttctggggcggccgcgaa
ggctacgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcgcgcgactacggccgcgcgattggcttcaagggcaatttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgacagcgccacggtgatcggc
ttcctgcgccagcatggcctggaccaggatttcaagctcaacatcgaggccaatcacgcc
accttgtccggccatagcttcgagcatgacctgcaggtggcatccgatgccggcctgctc
ggcagcatcgatgccaaccgcggcaacccgcagaacggctgggacaccgaccagttcccg
accgacctgtacgacaccgtcggcgccatgctggtggtgctgcggcagggcgggctggca
ccgggcggcttgaacttcgatgccaaggtgcgtcgcgaatcgtccgacccgcaggacctg
ttcctggcccacatcggcggcatggacgcgttcgcacgcgggctggaagtggccaacgcg
ctgctgaccgcctcgccgctggaacagtggcgcgccgagcgttacgccagcttcgacagc
ggcgccggcgcggactttgccgcaggcaagaccacgctggccgatctggccaagcacgcg
gccagcaatgcgccccagcaactcagcggccgccaggaagcgtatgaaaacctgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system