KEGG   Xanthomonas campestris pv. vesicatoria: XCV1815Help
Entry
XCV1815           CDS       T00288                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2048291..2048776
Genome map
AA seq 161 aa AA seqDB search
MQTAFVGLGANLGQAEASVRAAIAALGAVPQTTLIAASRLYRTPAWGREDQPDFINAVAQ
LRTGLAPLPLLEALLGIEQAFGRERRAGERWGPRTLDLDLLLYADQVIDLPQLQVPHPHL
HARAFALLPLSELAPEAIIPGHGTVRRALRAIDTCGLEPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgcctttgtcggcctgggtgccaacctgggccaggccgaggccagcgtgcgc
gcggccatcgccgcgctgggcgccgtgccgcagaccacgctgatcgccgcttcgcgtttg
tatcgcacgccggcctggggccgcgaagaccagcccgatttcatcaatgctgtggcccag
ctgcgcaccggtcttgcgccgctgccgttgctggaggccttgctcggcatcgaacaggcg
ttcggccgcgagcgtcgcgccggcgagcgctggggcccgcgcacgctggacctggacctg
ctgctgtacgccgatcaggtgatcgacctgccgcagttgcaggtgccgcatccgcatctg
cacgcgcgcgccttcgccctgctgccgctgtcggagctggcgccggaggcgatcatcccg
gggcatggaacagtgcggcgcgccctgcgcgccatcgatacctgcgggctggagccgatt
gggtag

DBGET integrated database retrieval system