KEGG   Xanthomonas campestris pv. vesicatoria: XCV1875Help
Entry
XCV1875           CDS       T00288                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xcv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:xcv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121614..2122909
Genome map
AA seq 431 aa AA seqDB search
MKILDWSQLDGAARTDALTRPVQTVATQTRDAVAALIADVRARGDAALREITARFDGVSL
ESFAVSEADFAAAEAAVAPELRQAMQDAVARIDAFHRAGMSEGYAVETAPGVVCEKIVRP
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCREVVLCTPPRKDGSVDPAVLVAAQLTGVR
RVFKLGGAQAIAAMAYGTESVPSCDKLFGPGNSYVTEAKQQVAQSGAAAIDMPAGPSEVL
VIADAGAQPAFVAADLLSQAEHGPDSQVLLLSDSDGLIDAVQVQLEVQLAQLSRADIARQ
ALAQSRMIKVQALDEAFAISNRYAPEHLILALREPRAWLAQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIDGIGQCALILARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctcgattggtcccaactcgacggtgccgcgcgaaccgatgcactgactcgc
ccggtacagaccgtggccacgcagacgcgcgacgcagtggctgcattgattgccgatgtg
cgtgcacgcggcgatgccgccttgcgcgagatcaccgcgcgtttcgatggcgtatcgctg
gagagcttcgccgtgagcgaagccgacttcgctgccgccgaagcggccgtggcgccggag
ctgcgccaggccatgcaagatgcggtcgcacgcatcgacgccttccaccgcgccggcatg
agcgagggctatgcggtggaaaccgcgcccggcgtggtgtgcgaaaagatcgtgcggccg
atcggacgtgtgggtctgtacgtgccggcaggcagcgcgccgttgccatcaaccgccttg
atgctgggtgtgccggcgcgtctggccggatgccgcgaggtggtgttgtgcacgccgccg
cgcaaggacggcagcgtggacccggcggtgctggtggccgcgcaactcaccggcgtgcgc
cgcgtgttcaagctcggtggcgcgcaggcgatcgcggcgatggcgtatggcaccgagtcg
gtacccagttgcgacaagctgttcggcccgggcaatagctatgtcaccgaagccaagcag
caggtggcccagtccggagcggcggcgatcgacatgccggccggcccctcggaggtcttg
gtgatcgccgatgcgggcgcgcagccggccttcgtggctgctgatctgttgtcgcaggcc
gaacacgggcccgattcgcaggtgctgttgctgtccgacagcgacgggttgatcgatgcg
gtgcaagtacagctggaagttcagcttgcgcaactgtcgcgtgccgacatcgcgcgccag
gcgctggcgcaatcgcggatgatcaaggtgcaggcgctggatgaggcgtttgcgatcagt
aatcgctatgcgccggagcacctgattcttgcgctgcgcgaaccgcgcgcgtggctggcg
caagtcgaagcggccggttcggtgtttcttggcgattacacgcccgaagcgcttggcgac
tactgcagcggcaccaatcatgtgctgccgaccagcggtgcggcgcgcgcctacagcggg
gtgagtgtggccagcttccagaatatggtcagcgtgcaggcagccagcaaggccggcatc
gacggcatcggtcaatgcgcattgatccttgcccgcgctgaggggctggatgcgcatgcc
aacgcggtggcgctgcgcatgggagtggcggcatga

DBGET integrated database retrieval system