KEGG   Xanthomonas campestris pv. vesicatoria: XCV2089Help
Entry
XCV2089           CDS       T00288                                 

Definition
siroheme synthase
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xcv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2381100..2382077)
Genome map
AA seq 325 aa AA seqDB search
MPLFPLFANLQGRAVLVIGGGEVATRKVLALLKAQAHIRLYAHALSPELAQLMQAGRFEQ
MTGEFDPAWIDTVWLVVAATDDVDLNQRVAAAAGARQRLVNVVDDAELSTYQVPAIVDRD
PLVIAISSAGAAPMLARRLRERLERELHASVGTLAALFARHRERIRQQLPDMNRRRRWFD
QVIDGKVPQLLQAGDTVAAEAAFAAALDAVDSVPARGSVQWVGAGPGDPGLLTLNALRAL
NLADVLLLASDVPAAVVELARRDAQRRAWPETPGAQQAAVVELVGAGLQVVVLRMGSGDA
IPAELDAALHAQGILSVRVPGLPLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgttcccgttgttcgccaacctgcaggggcgcgctgtgctggtgatcggtggc
ggcgaagtcgctacacgcaaggtgctggcgctgctgaaggcgcaggcgcacatccggctg
tatgcgcatgcgctttcgcccgaacttgcccagttgatgcaggccgggcgctttgagcaa
atgacaggcgagttcgatcctgcctggatcgacaccgtgtggctggtcgtcgccgccacc
gatgatgtggatctgaatcaacgtgtggccgcagcggccggcgcacgccagcgtctggtc
aatgtcgtggacgatgccgagctctccacctaccaggtgccggccattgtcgaccgcgat
ccgctggtgattgcgatttcgtcggcgggcgcggcgccgatgctggcgcgccgactgcgc
gagcgactggagcgcgaactgcatgcgtcggtgggtacgctggcggccttgttcgcccgg
caccgcgagcgcattcgtcagcagttgccggacatgaaccggcggcgccgctggttcgac
caggtgatcgacgggaaggtgccgcaattgctgcaggccggcgataccgtcgccgccgaa
gccgcctttgccgctgcgttggacgcggtggacagcgttccggcgcgcggcagcgtgcaa
tgggtcggtgccggcccgggcgatcccggcctgctcacgctcaatgccttgcgtgccctg
aacctggccgacgtgctgctgctggcgtcggacgtgcccgccgcggtggtggaactggcg
cgccgggacgcgcaacggcgcgcctggccggagacgccgggcgcgcagcaggccgccgta
gtggagttggtcggcgccgggctgcaggtcgtggtcctgcgcatgggcagcggcgatgcc
atcccggcggagctggacgccgcgctgcacgcgcagggcatcctgtcggtgcgggttccg
ggtttgccgctccgctag

DBGET integrated database retrieval system