KEGG   Xanthomonas campestris pv. vesicatoria: XCV2206Help
Entry
XCV2206           CDS       T00288                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XCV2206 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    XCV2206 (bdhA)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     XCV2206 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2536116..2536874)
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGIASQLAADGHHLLVSDVQLADAERTAEALRQAGASAEALALDVT
DADSIAQALANASRAPQVLVNNAGLQHVATLEEFPMQQWALLVDVMLTGAARLSRAVLPG
MRAAGYGRILNIGSIHSLVASPYKSAYVAAKHGLVGLAKVIALETADCDITVNTLCPSYV
RTPLVERQIADQARTRGIAEDAVVRDVMLKPMPKGAFIEYDELAGTVAFLMSHAARNITG
QAIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggcgcgggcagcggcattggcgccggtatcgccagccaa
ctggcggccgatggccatcatctactcgtcagcgatgtgcagctggcggacgccgagcgc
acggccgaggcgttgcgccaggcaggcgcctcggccgaggcgctggcgttggacgtgacc
gatgcagacagcattgcgcaggcactggccaacgcatcacgcgccccgcaggtactggtg
aacaatgccggcctgcagcatgtggccacactggaggagttcccgatgcagcagtgggcg
ctgctggtggatgtcatgctcaccggcgccgcacgcctcagtcgcgccgtgctgcccggc
atgcgtgcagccggctatggccgcatcctcaatatcggcagcatccactcgctggtggcc
agcccatacaaaagtgcgtatgtcgccgccaagcatggcctggtcggcctggccaaggtc
atcgcgctggaaaccgccgattgcgacatcaccgtcaacacgctctgccccagctatgtg
cgcacaccgctggtggagcggcagattgccgatcaggcgcgcacccgcggcatcgccgag
gacgcggtggtgcgcgatgtgatgctcaagccgatgcccaagggcgccttcatcgagtac
gacgagctagccggcacggtggcgtttctgatgtcgcatgccgcgcgcaacatcaccggg
caagccatcgccatcgacggcggctggacggcccaatga

DBGET integrated database retrieval system