KEGG   Xanthomonas campestris pv. vesicatoria: XCV2236Help
Entry
XCV2236           CDS       T00288                                 

Gene name
glk1
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00052  Galactose metabolism
xcv00500  Starch and sucrose metabolism
xcv00520  Amino sugar and nucleotide sugar metabolism
xcv00521  Streptomycin biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV2236 (glk1)
   00052 Galactose metabolism
    XCV2236 (glk1)
   00500 Starch and sucrose metabolism
    XCV2236 (glk1)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV2236 (glk1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCV2236 (glk1)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XCV2236 (glk1)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XCV2236 (glk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CAJ23913
UniProt: Q3BTE6
Position
complement(2568397..2569404)
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFGSLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQARNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSKVPSLAVMHPHAGLLGAAAYAVDAQRQHPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggaaccaatgcgcgcttc
gcgctggccgatgtcgacgcttcggtgccgttgctggatgacacctcgcgcgaatttgcc
gtggtggacttcggttcgctgggcgaagccgcgcgctattacctcgaccagatcggcgtg
caggccacccagggcgtgttcgccgtggcaggccgcgtggatggcgacgaggcacgcatc
accaaccatccctgggtgatctcgcgctcgcgcaccgccaccatgttgggtttcagtacc
ttgcatctgatcaacgactttgccgcgcaggccatggccatcagcctgctgcgcccgcag
gacgtggtgcaggtgggcggcgccagctggcggccggcgccgatcgatcaagcgcgcaac
tatggcgtgatcggcccgggcaccggcctgggcgtgggtggcctgatcattcgcaacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctgtccgagcagttcggccgggtctccaacgagcggctg
atctgcggccctggcctggtcaacatccatcgcgcgctcagcgagatcgccggcgtcgat
cccggcccgctgcaacccaaggacatcaccgcgcgcgcggccgcgggcgacccgcggtcc
tcgcgcaccatcgacctgttctgcgccatcttcggtgcgatcgccggcgacatggtgctg
atgcagggcgcctgggacggcgtgttcctcaccggcgggctggtgcccaaggtgctggat
tcgctccagcattccggctttcgccagcgcttcgagcacaagggccgtttctccgcgatc
atgtcgaaggtgccatcgctggcggtcatgcacccgcatgccggcctgctgggcgccgcc
gcatacgcggtggatgcacaacgtcagcaccccggggagcagcgatga

DBGET integrated database retrieval system