KEGG   Xanthomonas campestris pv. vesicatoria: XCV2242Help
Entry
XCV2242           CDS       T00288                                 

Definition
(GenBank) putative succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00020  Citrate cycle (TCA cycle)
xcv00190  Oxidative phosphorylation
xcv00650  Butanoate metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Module
xcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCV2242
   00650 Butanoate metabolism
    XCV2242
  Energy metabolism
   00190 Oxidative phosphorylation
    XCV2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAJ23919
UniProt: Q3BTE0
Position
2574002..2574388
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAATAAV
AKPWNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAV
ARIALGMS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctaccgtacccctctgaagaatgtgcgcggcctgggcgccgccaagaccggt
accgaacatttcgtgatccagcgcctgaccgcggccgcactggtgccgctgtcgatctgg
ttcctgatcttcgtgctgagcctgatcggtgccgatcacgccgccgccaccgccgcagtg
gccaagccgtggaatgcgattttgcttgtcgctttcctcattgcctcgttctggcatgcc
cagcttggcatgcaggtggtactggaagactacgtgcacgactcgctgctcgcactgatt
gcgcagaccctcgtgcgttttgttgccgtgctgggcgccatcgtcagcgtatttgccgtg
gcgcgtatcgcgctgggcatgagctga

DBGET integrated database retrieval system