KEGG   Xanthomonas campestris pv. vesicatoria: XCV2333Help
Entry
XCV2333           CDS       T00288                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XCV2333
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV2333
  Lipid metabolism
   00071 Fatty acid degradation
    XCV2333
  Amino acid metabolism
   00350 Tyrosine metabolism
    XCV2333
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XCV2333
   00626 Naphthalene degradation
    XCV2333
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XCV2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2663116..2664144
Genome map
AA seq 342 aa AA seqDB search
MKTTYRAMQVTRPGFLELVERPAPLPGIGEVLIEVEACGICGADASDIERADPALQPPRV
PGHEVVGRIAALGEHTPSIWKVGQRVGVGRMGGHCNECVQCRQGRFQLCLNQPITGASRD
GGYAEMMLARATGLVSIPDELDAEEAAPILCAGIATFNALKKCGAQAGDTVAVLGIGGLG
HMALQYARRMGFKVIAIGRGSDIAQDALKLGAHLYIDTNEEDATARLKSLGGAQAIVTMI
DHAETVSGLLAGLAPEGRLVVLNPSKQPLQVPAGLLVGGQRSILGSITGTPYENEKTLNF
SVLADVRPWIETMPLEKAYDAYQRMKSGDVKFRMVLTMNRPD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagactacctaccgcgcgatgcaagtcacccggccgggcttccttgagctggtggag
cgcccggcaccgctgccgggtatcggcgaggtgctgatcgaggtcgaagcctgcggcatc
tgcggtgccgatgccagcgacatcgagcgagccgatcccgcactgcaacctccgcgcgta
ccgggacacgaggtggtcggccgcattgccgcgctcggcgagcacaccccctcgatctgg
aaggtgggacagcgcgtgggcgtgggccgcatgggaggacactgcaatgaatgcgtgcag
tgccggcagggacgcttccagctttgcctgaaccagcccatcacaggagcgagccgcgac
ggtggctacgccgaaatgatgctggcgcgggccaccgggctggtatcgatcccggacgaa
ctcgatgccgaggaagccgcgccgattctgtgcgccggcattgcgaccttcaacgcgctc
aagaaatgcggcgcgcaggccggcgacacggtggccgtcctgggcatcggcggcctgggg
cacatggcattgcagtacgcgcgtcgcatgggattcaaggtcatcgccattggccggggc
agcgacatcgcgcaagatgcactgaagctgggtgcccacctctacatcgacaccaacgag
gaggacgcgaccgcccggctcaagagcctgggcggcgcacaggccatcgtgaccatgatc
gaccatgccgaaacggtatcggggctactggccggtctggcacccgaggggcgactggtg
gtgctcaacccgagcaagcagcccctgcaagtgcccgccggcctgctggtcggcggccag
cgcagcatcctcggctcgatcaccggcacgccctacgagaacgagaagacattgaacttc
agcgtcctggcagacgtgcgaccctggatcgaaaccatgcctctggaaaaggcctacgac
gcctatcagcggatgaaatccggcgacgtgaagttccgcatggtgttgaccatgaaccgc
ccagattga

DBGET integrated database retrieval system