KEGG   Xanthomonas campestris pv. vesicatoria: XCV2333Help
Entry
XCV2333           CDS       T00288                                 

Definition
(GenBank) putative Zn-dependent alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00071  Fatty acid degradation
xcv00350  Tyrosine metabolism
xcv00625  Chloroalkane and chloroalkene degradation
xcv00626  Naphthalene degradation
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV2333
  Lipid metabolism
   00071 Fatty acid degradation
    XCV2333
  Amino acid metabolism
   00350 Tyrosine metabolism
    XCV2333
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XCV2333
   00626 Naphthalene degradation
    XCV2333
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XCV2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_2 2-Hacid_dh_C AlaDh_PNT_C ThiF ELFV_dehydrog Tubulin_2
Motif
Other DBs
NCBI-ProteinID: CAJ24010
UniProt: Q3BT49
Position
2663116..2664144
Genome map
AA seq 342 aa AA seqDB search
MKTTYRAMQVTRPGFLELVERPAPLPGIGEVLIEVEACGICGADASDIERADPALQPPRV
PGHEVVGRIAALGEHTPSIWKVGQRVGVGRMGGHCNECVQCRQGRFQLCLNQPITGASRD
GGYAEMMLARATGLVSIPDELDAEEAAPILCAGIATFNALKKCGAQAGDTVAVLGIGGLG
HMALQYARRMGFKVIAIGRGSDIAQDALKLGAHLYIDTNEEDATARLKSLGGAQAIVTMI
DHAETVSGLLAGLAPEGRLVVLNPSKQPLQVPAGLLVGGQRSILGSITGTPYENEKTLNF
SVLADVRPWIETMPLEKAYDAYQRMKSGDVKFRMVLTMNRPD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagactacctaccgcgcgatgcaagtcacccggccgggcttccttgagctggtggag
cgcccggcaccgctgccgggtatcggcgaggtgctgatcgaggtcgaagcctgcggcatc
tgcggtgccgatgccagcgacatcgagcgagccgatcccgcactgcaacctccgcgcgta
ccgggacacgaggtggtcggccgcattgccgcgctcggcgagcacaccccctcgatctgg
aaggtgggacagcgcgtgggcgtgggccgcatgggaggacactgcaatgaatgcgtgcag
tgccggcagggacgcttccagctttgcctgaaccagcccatcacaggagcgagccgcgac
ggtggctacgccgaaatgatgctggcgcgggccaccgggctggtatcgatcccggacgaa
ctcgatgccgaggaagccgcgccgattctgtgcgccggcattgcgaccttcaacgcgctc
aagaaatgcggcgcgcaggccggcgacacggtggccgtcctgggcatcggcggcctgggg
cacatggcattgcagtacgcgcgtcgcatgggattcaaggtcatcgccattggccggggc
agcgacatcgcgcaagatgcactgaagctgggtgcccacctctacatcgacaccaacgag
gaggacgcgaccgcccggctcaagagcctgggcggcgcacaggccatcgtgaccatgatc
gaccatgccgaaacggtatcggggctactggccggtctggcacccgaggggcgactggtg
gtgctcaacccgagcaagcagcccctgcaagtgcccgccggcctgctggtcggcggccag
cgcagcatcctcggctcgatcaccggcacgccctacgagaacgagaagacattgaacttc
agcgtcctggcagacgtgcgaccctggatcgaaaccatgcctctggaaaaggcctacgac
gcctatcagcggatgaaatccggcgacgtgaagttccgcatggtgttgaccatgaaccgc
ccagattga

DBGET integrated database retrieval system