KEGG   Xanthomonas campestris pv. vesicatoria: XCV2490Help
Entry
XCV2490           CDS       T00288                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00040  Pentose and glucuronate interconversions
xcv00052  Galactose metabolism
xcv00500  Starch and sucrose metabolism
xcv00520  Amino sugar and nucleotide sugar metabolism
xcv01100  Metabolic pathways
xcv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCV2490 (galU)
   00052 Galactose metabolism
    XCV2490 (galU)
   00500 Starch and sucrose metabolism
    XCV2490 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV2490 (galU)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XCV2490 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAJ24167
UniProt: Q3BSP2
Position
complement(2810887..2811780)
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL
LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacagtgccgaaagaaatgctgccaatcatcgacaagccattgatccag
tacgccgtcgacgaagccatccaggctggttgcgatacgctgatcttcgttaccaaccgc
tacaagcactccattgccgactacttcgacaaagcctatgagctcgagcagaagctggag
cgcgcaggcaagctggagcagctggagctggtgcgccatgcattgcccgagggcgtccgc
gccatttttgtcacgcaggcagaggcgcttggcctgggccatgcggtgttgtgtgccaag
gccgttgtcggtgacgagccgttcgcggtgttgctgccggacgatctgatgtggaaccgc
ggcgatgctgcgctgacccagatggccaatgtggccgaggcctcgggcggcagcgtgatc
gccgtggaagacgtgccgcacgacaagaccgccagctacggcatcgtttccaccgacgcg
ttcgacggccgcaagggccgcatcaacgcgatcgtcgaaaagcccaagccggaagtcgcg
ccaagcaacctggccgtggtcggtcgttacgtgctgagccccaagatcttcgacctgctc
gaagccaccggtgcaggcgcgggcggcgaaatccagcttaccgatgcgattgccgagttg
ctgaaggaagagcaggtcgatgccttccgtttcgaaggtcgccgtttcgattgcggcgcg
cacatcggcctgatcgaagccaccgtgcatttcgcgcttgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaatgcactggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system