KEGG   Xanthomonas campestris pv. vesicatoria: XCV2490Help
Entry
XCV2490           CDS       T00288                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCV2490 (galU)
   00052 Galactose metabolism
    XCV2490 (galU)
   00500 Starch and sucrose metabolism
    XCV2490 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV2490 (galU)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XCV2490 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2810887..2811780)
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL
LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacagtgccgaaagaaatgctgccaatcatcgacaagccattgatccag
tacgccgtcgacgaagccatccaggctggttgcgatacgctgatcttcgttaccaaccgc
tacaagcactccattgccgactacttcgacaaagcctatgagctcgagcagaagctggag
cgcgcaggcaagctggagcagctggagctggtgcgccatgcattgcccgagggcgtccgc
gccatttttgtcacgcaggcagaggcgcttggcctgggccatgcggtgttgtgtgccaag
gccgttgtcggtgacgagccgttcgcggtgttgctgccggacgatctgatgtggaaccgc
ggcgatgctgcgctgacccagatggccaatgtggccgaggcctcgggcggcagcgtgatc
gccgtggaagacgtgccgcacgacaagaccgccagctacggcatcgtttccaccgacgcg
ttcgacggccgcaagggccgcatcaacgcgatcgtcgaaaagcccaagccggaagtcgcg
ccaagcaacctggccgtggtcggtcgttacgtgctgagccccaagatcttcgacctgctc
gaagccaccggtgcaggcgcgggcggcgaaatccagcttaccgatgcgattgccgagttg
ctgaaggaagagcaggtcgatgccttccgtttcgaaggtcgccgtttcgattgcggcgcg
cacatcggcctgatcgaagccaccgtgcatttcgcgcttgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaatgcactggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system