KEGG   Xanthomonas campestris pv. vesicatoria: XCV2797Help
Entry
XCV2797           CDS       T00288                                 

Gene name
cgt
Definition
cyclomaltodextrin glucanotransferase precursor (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     XCV2797 (cgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3178053..3179726)
Genome map
AA seq 557 aa AA seqDB search
MRSAMYVALTMYAGAAMAAPAAKDYYGTLEPFAAEAVYFVVTDRFVNGDTGNDHRDQGGA
HRTFDVPTPCADGSEDNIGYLGGDFKGIVEHADYIRDLGFGAVWITPIVDNPDEAFTGGK
PITCGSTLSDHGKTGYHGYWGVNFYKLDEHLPSPGLDFAGFTRAMHASKLKVVLDIVGNH
GSPAYTMPQAQPGFGKLYDAQGRLVADHQNLAPAQLDPQHNPLHAFYNTGGGLAELSDLN
ENNPAVLDYLAGAYLQWMEQGADAFRIDTIGWMPDRFWHAFVARIREKRPGFFMFGEAFD
YDTNKIAGHTWTRNAGVSVLDFPLKQQLAAVFGHEQAGFEKLAVPLFLRQGPYANPYELM
SFYDNHDMARLDASDAGFIDAHNWLFTARGIPVIYYGSEIGFMRGRAEHAGNRNYFGVER
IRTAQQSPIFGPLQRIAQVRRNTPALQRGVQVDVRLHGDQAAFLRVYQHAGTTQTALVLL
NKADTAATIQVTRFLQPGAWRDAVSGEQLQVQRGFATAVPAHGVRVLLSDAPITDPALRK
QLDLQMVEQAARDARNR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtgcgatgtatgtggcgttgacgatgtacgcaggcgcggcaatggcggcgcct
gcagccaaggactactacggcaccctggagccgtttgccgccgaggcggtgtacttcgtg
gtgaccgaccgcttcgtcaacggcgataccggcaacgaccatcgcgatcagggtggtgcg
catcgcaccttcgatgtgcccacaccatgcgccgatggcagcgaggacaacatcggctat
ctcggtggcgacttcaaaggcatcgtcgagcatgccgattacatccgcgacctgggcttc
ggggcggtgtggatcaccccgatcgtcgacaaccccgacgaagcgttcaccggcggcaag
ccgatcacctgcggcagcacgctcagcgaccatggcaagaccggctatcacggctattgg
ggcgtcaacttctacaagctcgatgaacatctgcccagcccgggcctggatttcgccggc
tttacccgcgccatgcatgccagcaagctgaaggtcgtattggacatcgtgggcaaccac
ggttcgccggcctacaccatgccgcaggcgcaacccggcttcggcaaactctacgatgca
caggggcgcctggtcgccgaccaccagaatctcgcgcctgcgcaactggatccgcagcac
aacccattgcatgccttctacaacaccggcggcggcctggcggaattgtccgacctcaac
gaaaacaatccggcggtgctggattatctggccggcgcgtacctgcagtggatggagcag
ggcgccgatgcgtttcgcatcgataccatcggctggatgccggatcgcttctggcatgcc
ttcgtggcgcgcattcgtgaaaaacgtccgggttttttcatgttcggcgaagccttcgat
tacgacaccaacaagatcgccgggcatacctggacgcgcaatgccggcgtcagcgtgctg
gatttcccgctcaagcagcagcttgccgcggtattcggtcatgaacaggccggcttcgaa
aaactcgccgtgcccttgttcctgcgtcaagggccctatgcgaacccctacgagttgatg
agcttctacgacaaccacgacatggcgcgtctggatgccagcgatgccgggtttatcgat
gcacacaactggttgttcaccgcccgcggcattccggtgatctattacggctcggaaatc
ggcttcatgcgtgggcgtgccgaacatgccggcaatcgcaactacttcggcgtcgagcgc
attcgcactgcacagcagagcccgatcttcggcccgctgcaacgcatcgcccaggtgcgt
cgcaacaccccggcattgcagcgtggcgtgcaggtcgatgtgcggttacacggcgatcaa
gccgcgttcctgcgcgtctatcagcatgcaggtacaacccagaccgcattggtgctgctc
aacaaggccgataccgcagccaccattcaagtgacgcgcttcctgcagcctggcgcgtgg
cgcgatgcggtcagtggcgagcagttgcaggtgcagcgtggtttcgcaacagcggtgccg
gcgcacggcgtgcgcgtgttgctgtcggatgcgccgatcaccgacccggccctgcgtaag
cagctcgacctgcaaatggtcgagcaggctgcacgcgacgcgcgcaacaggtag

DBGET integrated database retrieval system