KEGG   Xanthomonas campestris pv. vesicatoria: XCV2869Help
Entry
XCV2869           CDS       T00288                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00260  Glycine, serine and threonine metabolism
xcv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01130  Biosynthesis of antibiotics
xcv01230  Biosynthesis of amino acids
Module
xcv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCV2869 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCV2869 (trpB)
Enzymes [BR:xcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XCV2869 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAJ24548
UniProt: Q3BRL3
Position
complement(3261238..3262455)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHSFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPRDALVLCNLSGRGDKDVHTIAAREGIAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggtcacttcggc
aagttcggtggccgtttcgtcgccgaaaccttgatcggcccgctgcaggaattgtccgcc
gcctacgatcaggcacggcaggacccgagtttcattgccgaatacgacaaggacctcaag
cattacgtcggccggcccagcccgatctaccacgccgagcggctcagccgtgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgttggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtcgccagtgccaccgtggcggcacgcctgggcctggaa
tgcgtggtctacatgggcgccaccgacatcgagcggcaaaagatcaacgtctaccgcatg
aagctgctcggcgccacggtgatcccggtgacttccggctcggccacgctcaaggacgcg
ctcaacgaagccatgcgcgactgggtgaccaacgtgcgcgacaccttctacatcatcggc
accgtggctggcccggacccatacccgcgcatggtgcgcgacttcaatgcgattgtcggt
cgcgaggcgcgcgaacagatgctgcaggactatggtcggctgccggatgcgatcagtgcc
tgcgtgggtggcggcagcaatgcgatcggtttgttccatgccttcctcaatgatccgggc
gtcaagatctatggcgccgaagcggccggcgatggcatcgccaccggccgccacgccgcc
tccatcgccgcaggtcgcccgggcgtgctgcacggcaaccgcacctacgtgatctgcgac
gatgacggccagatcaccgagacccattcgatttccgccggcctggattacccgggtgtg
ggcccggagcattcgttcctgtccgacagcggtcgcgcggtgtaccagggcattaccgac
gacgaggcgatggccgccttccatctgctggcgcataccgaaggcattcttgccgcgctc
gagtccagccatgcggtggcgcagtcgatcaagcttgcgcgcgagctgcccagggatgcg
ctggtgttgtgcaatctgtccgggcgtggcgataaggatgtgcataccatcgcagcgcgc
gaggggatcgctctttaa

DBGET integrated database retrieval system