KEGG   Xanthomonas campestris pv. vesicatoria: XCV2869Help
Entry
XCV2869           CDS       T00288                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCV2869 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCV2869 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCV2869 (trpB)
Enzymes [BR:xcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XCV2869 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3261238..3262455)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHSFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPRDALVLCNLSGRGDKDVHTIAAREGIAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggtcacttcggc
aagttcggtggccgtttcgtcgccgaaaccttgatcggcccgctgcaggaattgtccgcc
gcctacgatcaggcacggcaggacccgagtttcattgccgaatacgacaaggacctcaag
cattacgtcggccggcccagcccgatctaccacgccgagcggctcagccgtgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgttggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtcgccagtgccaccgtggcggcacgcctgggcctggaa
tgcgtggtctacatgggcgccaccgacatcgagcggcaaaagatcaacgtctaccgcatg
aagctgctcggcgccacggtgatcccggtgacttccggctcggccacgctcaaggacgcg
ctcaacgaagccatgcgcgactgggtgaccaacgtgcgcgacaccttctacatcatcggc
accgtggctggcccggacccatacccgcgcatggtgcgcgacttcaatgcgattgtcggt
cgcgaggcgcgcgaacagatgctgcaggactatggtcggctgccggatgcgatcagtgcc
tgcgtgggtggcggcagcaatgcgatcggtttgttccatgccttcctcaatgatccgggc
gtcaagatctatggcgccgaagcggccggcgatggcatcgccaccggccgccacgccgcc
tccatcgccgcaggtcgcccgggcgtgctgcacggcaaccgcacctacgtgatctgcgac
gatgacggccagatcaccgagacccattcgatttccgccggcctggattacccgggtgtg
ggcccggagcattcgttcctgtccgacagcggtcgcgcggtgtaccagggcattaccgac
gacgaggcgatggccgccttccatctgctggcgcataccgaaggcattcttgccgcgctc
gagtccagccatgcggtggcgcagtcgatcaagcttgcgcgcgagctgcccagggatgcg
ctggtgttgtgcaatctgtccgggcgtggcgataaggatgtgcataccatcgcagcgcgc
gaggggatcgctctttaa

DBGET integrated database retrieval system