KEGG   Xanthomonas campestris pv. vesicatoria: XCV3029Help
Entry
XCV3029           CDS       T00288                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00260  Glycine, serine and threonine metabolism
xcv00680  Methane metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
xcv01230  Biosynthesis of amino acids
Module
xcv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3029 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XCV3029 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCV3029 (gpmA)
Enzymes [BR:xcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCV3029 (gpmA)
Membrane trafficking [BR:xcv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XCV3029 (gpmA)
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCV3029 (gpmA)
  Exosomal proteins of melanoma cells
   XCV3029 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAJ24740
UniProt: Q3BR53
Position
complement(3449195..3449944)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVNDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDNLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcattgaaggaactggaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggcggcctgcaagggctggacaaggcc
gaaaccgcggccaagcacggcgaggagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggcgatggacgtcaacgacccgggccacccgtgccatgaccggcgctacgcc
accctggaccgcaacgctcttccggggaccgagtcgttggcaaccacgctggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggtaattcgctgcgcgcgctgtacaagtacctcaacgatgtctccaacgag
cagatcctcgagctcaacatccccacaggcatcccgttgctgttcgagctggacgacaac
ctgcaggtgcgcagcttccgttacctgggcgacccggaagcggccaagcgcgcggccgaa
gcggtggccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system