KEGG   Xanthomonas campestris pv. vesicatoria: XCV3029Help
Entry
XCV3029           CDS       T00288                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV3029 (gpmA)
   01230 Biosynthesis of amino acids
    XCV3029 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3029 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XCV3029 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCV3029 (gpmA)
Enzymes [BR:xcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCV3029 (gpmA)
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCV3029 (gpmA)
  Exosomal proteins of melanoma cells
   XCV3029 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3449195..3449944)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVNDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDNLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcattgaaggaactggaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggcggcctgcaagggctggacaaggcc
gaaaccgcggccaagcacggcgaggagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggcgatggacgtcaacgacccgggccacccgtgccatgaccggcgctacgcc
accctggaccgcaacgctcttccggggaccgagtcgttggcaaccacgctggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggtaattcgctgcgcgcgctgtacaagtacctcaacgatgtctccaacgag
cagatcctcgagctcaacatccccacaggcatcccgttgctgttcgagctggacgacaac
ctgcaggtgcgcagcttccgttacctgggcgacccggaagcggccaagcgcgcggccgaa
gcggtggccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system