KEGG   Xanthomonas campestris pv. vesicatoria: XCV3204Help
Entry
XCV3204           CDS       T00288                                 

Gene name
glk2
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00052  Galactose metabolism
xcv00500  Starch and sucrose metabolism
xcv00520  Amino sugar and nucleotide sugar metabolism
xcv00521  Streptomycin biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3204 (glk2)
   00052 Galactose metabolism
    XCV3204 (glk2)
   00500 Starch and sucrose metabolism
    XCV3204 (glk2)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV3204 (glk2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCV3204 (glk2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XCV3204 (glk2)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XCV3204 (glk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CAJ24935
UniProt: Q3BQM8
Position
complement(3641716..3642732)
Genome map
AA seq 338 aa AA seqDB search
MSASSPMEAVAFPRHETFVAADVGGTHVRLALVCESDDASKPVTVLDYRKYRCAEYPGLA
DIMTTFFAELGCAPVRRGVIASAGYALEDGSVITTNLPWVLAPEQIRRQLGMQALHLVND
FEAVAYAANYMIGNQVMQLSGPAQGAAGPALVLGPGTGLGAALWIPNGAHPVVLPTEAGH
AALAPASDLEMALLQELRRTRTHVGTETLLSGPGLLNLYTVLAALRGDSVVHATPADITA
AAMAGNDGLAHDALQAFCGFMGSVVGDLMLLYGVRSGVYLAGGFLPQIASFIAESDFVAR
LLDKGALRPALEQVPVSIVEHGQLGVIGAASWFLQHGR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaagcagtccaatggaagcggtggcctttccgcgccacgaaaccttcgttgcc
gccgatgtgggcgggacgcacgtgcgcctggcgctggtgtgcgaaagcgatgacgcaagc
aagccggtcacggtgctggactaccgcaagtaccgctgcgccgagtatccgggtctggcc
gacatcatgaccacgttcttcgcggaactgggatgtgcaccagtccgccggggcgtgatc
gccagcgccggctacgcgctggaagacggcagcgtgatcaccaccaatctgccctgggtg
ctggcacccgagcagatccgccgccagctcggcatgcaggccctgcatctggtcaacgat
ttcgaagcggtcgcctacgcggccaattacatgatcggcaaccaggtcatgcagttgtct
ggcccggcgcaaggtgccgcgggcccggccttggtgcttggtccgggcactggcctgggc
gcggcgctgtggatccccaacggtgcccatccggtggtgctgcccaccgaagccggccac
gcggcactggcgccggccagcgatctggaaatggcgttgctgcaggaactgcggcgcacg
cgtactcacgtgggtaccgaaacgctgttgtccggcccgggcctgttgaatctgtacacc
gtgctggccgccttgcgcggcgacagcgtggtgcatgccaccccggccgacatcaccgcg
gccgcaatggccggcaacgatggattggcgcacgacgcgctgcaagcgttttgcggattt
atgggcagcgtggtcggcgacctgatgttgctgtatggcgtgcgcagtggcgtctatctg
gccggcggtttcctgccgcaaatcgccagcttcatcgccgagagcgattttgtcgcgcgc
ctgctcgacaaaggcgccttgcgtcccgcgttggagcaggtgccggtgagcatcgtcgag
cacggccagctcggcgtcatcggtgctgccagctggttcctgcagcacggccgctga

DBGET integrated database retrieval system