KEGG   Xanthomonas campestris pv. vesicatoria: XCV3209Help
Entry
XCV3209           CDS       T00288                                 

Gene name
nahA
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xcv00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xcv00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3649207..3651780
Genome map
AA seq 857 aa AA seqDB search
MTTRCPRCAAGPSVRQSLRLPIRLCYCAWLPCTAAIPGCDCMTSNSAPTARLTAVAPFSS
RLLALAFAAVSLAGCGQRAPGTSPAAATAGAPAAATADTAGTPLPLIPAAVEVKRGSGSF
TVGAGTVISIVPGDADARRSAEHLADLLQRTRGLRLEVRAEASASPGSIRLERSAQAPVA
HKEGYSLEADARGVRIAARDGAGLLYGAISAWQLMTPDARKGEVQLPAVAIRDWPRFSWR
GQHLDVARHFHDVDTVKHVLDTMALHKLNVLHWHLTDDQGWRIEIKRYPKLTEVGAWRTP
PGAGQHGTPQRYGGFYTQEQISEIVAYAARLHITVLPELDMPGHAQAAVAAYPEDVGVPG
ARTQVGVDWGVNPYLFNTSERSLTFITNVLDEVLTLFPSTYIHIGGDEAVKDQWEASPAV
RAQMRKLGVKDAHAMQGWFNEQLAAYLTQHGRRMIGWDEILEGGVPASASVMSWRGIEGA
VIAAQQGHDVVLAPGDWLYLDNLQTTRSDEPNGRLTVLPLSKVYAFGPVPAELSAEQARH
VLGAQGALWSEYIPSQWHVDHALFPRLSAIAEVTWSPPAARNWNSFLARMPAQLQRYKAL
GIDYSDGAFAADIALEGGPNPVLAGGPAKVTLSTQAGAGTLHYTIDGSEPTPASPRYSAP
LTIRLPTTVKATAFDANGTPLAATRSRTFDRASLLRVDTQGLQHCVETGALGLRLPLLPE
MTGADTPVYNVDLFHACRLYPQARLDGIGAIRIDAARLPNNFGLAHEQSKVVQYPAKTRG
GELEVRLGCDGDLIASVQLPRSDTLGEQFTLETALPARTGIHDLCLRFTAPIRGPLYAIG
AVQLIETTAQAPPAATR
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcggtgcccacgctgcgcagcgggaccaagcgtgcgccagtcactgcgtctt
ccgatacggctttgctactgtgcgtggctgccgtgtaccgccgccataccgggatgtgat
tgcatgacgtcgaactccgcacccaccgcacgcctgacagccgtcgcgccgttctcctcg
cgcctgcttgcgcttgcgttcgcagcagtgtcgctggccggctgcggtcaacgtgcacca
ggcacctcgccggccgctgccaccgccggcgcacctgctgccgcaaccgcagacactgcg
ggtaccccgttgccactgattcccgcagcagtcgaggtcaaacgcggtagcggcagcttc
acggtgggcgccggcacggtgatttcgatcgtgcccggcgatgccgatgcacgccgcagt
gccgaacatctggccgatttgctgcaacgcacacgcgggctgcggttggaagtgcgcgcc
gaagccagcgcatcgccgggcagcatccgcctggagcgcagcgcgcaggcgccggtagcg
cacaaggaaggctacagcctggaggccgacgccaggggcgtgcgcatcgccgcgcgcgat
ggcgccggcttgttgtacggcgcaatcagcgcctggcaattgatgacaccggatgcacgc
aagggcgaggtccagctgccggcggtggcgattcgcgactggccgcgtttcagctggcgc
ggccagcacctggatgtggcccggcatttccatgacgtggacacggtcaagcatgtgctc
gatacgatggccctgcacaagctcaacgtgctgcattggcatctcaccgatgaccagggc
tggcgcatcgagatcaagcgctatcccaagctcaccgaggtaggcgcatggcgcacaccg
cccggcgccggccagcacggcacgccgcagcgttatggcggcttctacacccaggaacag
atcagcgagatcgtcgcctatgcggcgcgcctgcatatcacggtgctgccggaactggac
atgcccggccatgcgcaggcagccgttgccgcctaccccgaagacgtgggcgtacccggc
gcacgcacgcaggtgggcgtggactggggcgtcaacccgtacctgttcaacaccagcgaa
cgtagcctgaccttcatcaccaacgtgctggacgaagtgctgaccttgttcccatcgacc
tacatccacatcggtggcgatgaggcggtgaaggatcaatgggaagcctcgccggcggtg
cgcgcgcagatgcgcaagctcggggtcaaggacgcgcatgcgatgcagggctggttcaac
gaacagctggcggcctacctcacccagcacggccggcgcatgatcggctgggatgaaatt
ctggaaggcggcgtgccggccagtgcgtcggtgatgtcgtggcgcggcatcgaaggcgcg
gtgattgcagcacagcaaggccatgatgtggtgctggcgccgggcgactggctgtatctg
gacaacctgcagaccacgcgcagtgacgaaccgaacggtcgcctcacggtgttgccgctg
tcgaaggtctacgcattcggcccggtaccggccgagctcagcgccgaacaggccaggcat
gtactgggcgcacaaggcgcgttgtggtccgaatacatcccctcgcagtggcatgtggat
cacgccttgttcccgcggttatctgcaatagcggaagtgacctggtcgccgccggcagcg
cgcaactggaacagctttctggcccgcatgccggcgcagctgcagcgctacaaggcgctg
ggcatcgattacagcgacggcgccttcgctgccgatatcgcgctggaaggcggacccaat
ccggtgctcgccggcgggccggccaaggtgacactgagcacgcaagccggcgcgggcacg
ctgcactacaccatcgacggcagcgagcccacgccggcatcgccgcgctacagcgcgccg
ttgacgattcgattgccgaccacggtcaaggccacggcgttcgatgcgaacggcacgccg
ctggcggccacgcgcagccgtaccttcgatcgcgccagtttgttgcgggtggatacgcag
ggactgcagcactgcgtcgaaaccggcgcgctcggcttgcggctgccgctgctgccggag
atgaccggcgccgacacgccggtgtacaacgtcgacctgttccatgcctgccgcctgtat
ccgcaggcacggctggacggtatcggcgcaatccgcatcgacgccgcacgcctgcccaac
aacttcggcctggcgcacgagcaatccaaggtcgtgcaatacccggccaaaacccgcggc
ggtgagctggaagtgcgtctgggctgcgacggcgatctgatcgccagcgtgcagctgccg
cgcagcgacaccctgggcgaacaattcaccctggaaaccgcactgcctgcacgcaccggc
atccacgatctctgcctgcgcttcaccgcgccgatccgcggccccctgtatgccatcggc
gccgtccaactgattgaaaccactgcgcaggcgccccccgccgccacgcgctga

DBGET integrated database retrieval system