KEGG   Xanthomonas campestris pv. vesicatoria: XCV3214Help
Entry
XCV3214           CDS       T00288                                 

Gene name
bga1
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XCV3214 (bga1)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XCV3214 (bga1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3661943..3663895
Genome map
AA seq 650 aa AA seqDB search
MLFLLPQAGEGARRADEGRTQTPPPAIHPHHRPTYIETSMLRTTLAPLVLALALALPAAA
TTPKPWPAFGMQGTQFVRDGKPYQLLSGAIHFQRIPRAYWKDRLQKARALGLNTVETYVF
WNLVEPQQGQFDFSGNNDVAAFVREAAAQGLNVILRPGPYACAEWEAGGYPAWLFGKGNI
RVRSRDPRFLAASQSYLDALAKQVQPLLNHNGGPIIAVQVENEYGSYADDHAYMADNRAM
YVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPGEAKSAFDKLIKFRPDQPRMVGEY
WAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLYMFIGGTSFGFMNGANFQNNPSDH
YAPQTTSYDYDAILDEAGHPTPKFALMRDAIARVTGVQPPALPAPIATATLPATPLRESA
SLWDNLPAPIAIDTPQPMEQFGQDYGYILYRTTVTGPRKGPLYLGDVRDVARVYVDQRPV
GSVERRLQQVSLEVEIPAGQHTLDVLVENSGRINYGTRMADGRAGLVDPVLLDNQQLTGW
QAFPLPMRTPDSIRGWTRKAVQGPAFHRGALRIGTPTDTYLDMRAFGKGFAWANGVNLGR
HWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSVRGLKQQVWLTPKE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttccttctcccgcaagcgggagaaggtgcccgcagggcggatgagggcagaacg
caaacaccgccgcctgccatccacccgcaccaccggcccacctacatcgagacctccatg
ctgcgtaccactcttgctcccctggttctggccctggcgctcgcgctacccgccgccgct
accacacccaagccctggcccgccttcggcatgcagggcacgcaattcgtgcgcgacggc
aagccgtaccagctgctctccggcgccatccatttccagcgcattccgcgcgcctactgg
aaagaccgcctgcaaaaagcgcgtgccctgggcttgaacaccgtagaaacctacgtgttc
tggaatctggtggaaccgcagcaaggccagttcgatttttccggcaacaacgatgtggcc
gcgttcgtgcgcgaagccgccgcgcagggcctcaacgtcatcctgcggcccggcccttac
gcctgtgcggagtgggaagccggcggctacccggcctggttgttcggcaagggcaatatt
cgcgtccgcagccgcgatccgcgctttctcgccgccagccagtcctatctggatgcgttg
gccaaacaggtgcagccgctgctcaaccataacggcgggccgatcatcgccgtgcaggtc
gagaacgaatacggctcctacgccgacgatcacgcctacatggccgacaaccgcgccatg
tacgtcaaggctggcttcgacaaggccttgctgttcacctccgatggcgccgacatgctc
gccaacggcaccttgccagacaccctggcggtggtgaacttcgcacccggcgaggccaag
agcgcattcgacaaactgatcaagttccgccccgatcaaccgcgcatggttggcgaatac
tgggccgggtggttcgaccactggggcaagccgcatgccgccaccgatgccaggcaacag
gccgaggagttcgagtggatcctgcgccagggccactcggccaatctctacatgttcatc
ggcggcaccagtttcggcttcatgaatggcgccaatttccagaacaatcccagcgaccat
tacgcgccgcagaccaccagttacgactacgacgccatcctcgacgaagccggccacccc
acgcccaaattcgcgttgatgcgcgatgccatcgcccgcgtgaccggcgtgcaaccgccc
gcattaccggcaccgatcgccaccgccacgctgccggccacgccgctgcgcgaatcggcc
tcgctctgggacaacctgcccgcgccgatcgccatcgacaccccgcagccgatggaacag
ttcggccaggattatggctacatcctctaccgcaccacggtcactggcccgcgcaagggc
ccgctgtatctgggcgacgtgcgcgatgtggcacgcgtgtacgtggatcaacggccggtc
ggcagcgttgagcggcgtttgcagcaggtgtcgctcgaggtggagattcctgcaggccag
cacaccctggatgtgctggtcgaaaacagcggccgcatcaattacggcacgcgcatggcc
gacggccgcgccgggctggtggacccggtgctactggacaaccagcagctcaccggctgg
caggccttcccgctgccgatgcgcacgcccgacagcatccgcggctggacccgcaaggca
gtgcaaggcccggcgtttcaccgcggcgccctgcgcatcggcacgccgaccgacacctat
ctggacatgcgcgccttcggcaagggctttgcctgggccaacggcgtcaacctgggccgc
cactggaacatcggcccgcagaccgcgctgtatttccccgcgccgttccagcgcaagggt
gacaacacggtggtggtcttcgacctggacgatgtcgccacccccagcgtgcgcggcctg
aagcagcaggtatggctcacgccgaaagagtga

DBGET integrated database retrieval system