KEGG   Xanthomonas campestris pv. vesicatoria: XCV3251Help
Entry
XCV3251           CDS       T00288                                 

Gene name
glk3
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV3251 (glk3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3251 (glk3)
   00052 Galactose metabolism
    XCV3251 (glk3)
   00500 Starch and sucrose metabolism
    XCV3251 (glk3)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV3251 (glk3)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCV3251 (glk3)
   00524 Butirosin and neomycin biosynthesis
    XCV3251 (glk3)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XCV3251 (glk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3713763..3714797
Genome map
AA seq 344 aa AA seqDB search
MAAISRSAYASASPDVPVATSFVAADVGGTHVRVGHMLQTRDAAIELSHYRTYRCAEHAS
LQAILEDFLQQRRRVDAVVIASAGVALDDGSFISNNLPWTISPSRIGTALAVRDVHLVND
FEAVAYAAPQMEQRAVLQLSGPTPRHARANGPILVVGPGTGLGAALWIDAKPRAIVLATE
AGQVALASTHPHEYALLQRLLRGRHYLPLEHVLSGPGLLHLYHAVCELHGATPLHRLPAA
VTHAALHENDALARECLQIFCGLLGSAVGDMALAYGAAGGIYLAGGFLPTIGQFLAGSTF
AERFLDKGNMRAVLERIPVKLVEHGQLGVLGAANWYLQHHTELS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcgatttcgcgttccgcttacgcctctgcctcgcccgatgtccccgttgccacc
agcttcgtcgctgccgatgtcggtggcacgcatgtgcgtgtcgggcacatgctgcagacg
cgcgatgcagccatcgagctttcgcattaccgcacctatcgctgcgccgaacacgccagt
ctccaggccatcctcgaggacttcctgcaacagcggcgccgcgtcgatgcggtggtcatc
gccagtgccggcgtagcgctggacgatggcagcttcatcagcaacaacctgccctggacg
atttcgcccagccgcatcggtaccgcactggcggtgcgcgacgtgcacctggtcaacgat
ttcgaggcggtggcctacgcagcgccgcagatggaacaacgcgccgtgctgcagctgagc
gggcccacgccgcgccatgcgcgcgccaacggtccgattctggtggtcggccccggcacc
ggtctgggtgcagcactgtggatcgatgccaagccacgcgcaatcgtgctggctaccgaa
gccggccaggtcgcgctggccagcacccacccgcacgaatacgccttgctgcaacgcctg
ttgcgtggccggcactatctgccgctcgagcacgtgctttccggcccgggcttactgcat
ctctaccacgcggtgtgcgagctgcatggcgcaacgccgctccatcgcctgcccgccgcc
gtgacgcacgcagcgctgcacgaaaacgatgcgcttgcgcgcgagtgcctgcaaattttt
tgtggcctgctggggagcgcggtcggcgacatggcactggcctacggcgctgccggtggc
atctatctggccgggggcttcctgccgacgatcggccagttcctggctggcagcacattc
gccgagcgcttcctggacaagggaaacatgcgcgcggtgctcgaacgcatcccggtcaaa
ttggtcgagcacgggcaactgggcgtgctcggcgcggccaactggtatctgcaacaccac
accgagctgtcgtaa

DBGET integrated database retrieval system