KEGG   Xanthomonas campestris pv. vesicatoria: XCV3349Help
Entry
XCV3349           CDS       T00288                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV3349 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCV3349 (sucC)
   00640 Propanoate metabolism
    XCV3349 (sucC)
   00660 C5-Branched dibasic acid metabolism
    XCV3349 (sucC)
Enzymes [BR:xcv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XCV3349 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3833667..3834836)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVAATPDEAVEVANSLGNGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYRLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgttccg
gccggcaaggtcgcggcgaccccggacgaagcggttgaagtcgccaattccctgggcaat
ggcccctggatggtgaaggcgcagatccacgcgggcggccgcggtaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagccgccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaacctggtgctggtcaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacatacatcgcctcttccgaaggcggcgtggagatcgagcaggtcgctgccgagacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggctaccacggc
cgcgatttcggcttcaagctcggcctcaacgccaagcaggccggccagttcgccagcatc
atggtgaacctgtatcgcctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggacggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctggtcgccatgcgcgacaagacgcaggaagacgag
accgaagtgaccgcgtcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgcaggcctggccatggccaccatggacgtgatcaagctcaatggc
ggtgagccggcgaacttcctggacgtgggtggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgatcgccgaaggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system