KEGG   Xanthomonas campestris pv. vesicatoria: XCV3554Help
Entry
XCV3554           CDS       T00288                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV3554 (pfkA)
   01230 Biosynthesis of amino acids
    XCV3554 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3554 (pfkA)
   00030 Pentose phosphate pathway
    XCV3554 (pfkA)
   00051 Fructose and mannose metabolism
    XCV3554 (pfkA)
   00052 Galactose metabolism
    XCV3554 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XCV3554 (pfkA)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XCV3554 (pfkA)
Protein phosphatases and associated proteins [BR:xcv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XCV3554 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4070901..4072157
Genome map
AA seq 418 aa AA seqDB search
MTTGNLLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQDPDDAPQIILLPERAYDQAAFLAKVKQVVDKVGWCVV
VASEGIQDAHGKFVADAGGATDSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYAIKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPKYVSLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacctgctctatgcccaatccggcggcgtcaccgccgtcatcaacgcc
actgcagccggcgtcatcgccgaagcgcgcgcacgcaagatcaaggtgctggccgcacgc
aacggcatcctgggcgccttgcgcgaggagttgatcgacacctccaaagagtccgccgcc
gccattgccgccctggcgcagacgcccggcggtgcattcggctcgtgccgctataagctc
aaatcgctggaagaagacagcgccaagtacgagcgcctgctcgacgtgctgcgcgcgcac
gacgtccgctggttcctctacaacggcggcaacgactcggccgacaccgcgtggaaggtc
tcgcagctcgcaaaggcctatgggtacccgctgcactgcatcggcgtgccaaagaccatc
gacaacgatctggcagtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtacgcgaggccgcactggatgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaggcgatgggccgccatgccggctggctggccgcagcggcaggcctg
gccgggcaagacccggacgacgccccgcagatcatcctgctgcccgaacgcgcctacgac
caggctgcattcctggccaaggtgaaacaggtggtggacaaggtgggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacacggcaagttcgtcgccgatgccggcggcgcg
accgactcgttcggccatgcacagctcggcggcgtggcctcgttcctggccgcacaggtc
aagcaggagcttggctacaaggtgcactggacgctacccgattacctgcagcgctccgcg
cgccatctggcatcgaagacggactgggaacaggcgcaagcagtcggcaaggccgccgtg
cagtacgcgatcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacgca
ccataccgctggaagatcgtgcctgcgcccctgcacaaggtggccaatcacgaaaagaag
atgccgcccagcttcctgcgcaaggacggcttcggcatcaccgaacgcgcccgccgctat
ttcgccccgttgatcaagggcgaagccccgctggcctacggcagcgatggcttgccgaag
tatgtgagtttgaagaatgtcgcggtggcgaagaagttgccggcttgggaggggtga

DBGET integrated database retrieval system