KEGG   Xanthomonas campestris pv. vesicatoria: XCV3590Help
Entry
XCV3590           CDS       T00288                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XCV3590 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 CMAS Methyltransf_12 Methyltransf_23 MTS PrmA Methyltransf_24 NodS GCD14 Methyltransf_18 Methyltransf_3 tRNA_U5-meth_tr Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: CAJ25321
UniProt: Q3BPJ2
Position
4123169..4123825
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIPLSAGH
KMMKPVVEGRMLQALDLQPGEDVLEIGTGSGFATACLAALAREVLSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFGWQSERRFDAICVTGAVHTLPVQWLQWLRPNGRLFVVRGHDP
VMEAVLVRGEVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggtcgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagacgctggcctatgtcgacgtggaaattccgctgtcggccggtcac
aagatgatgaagccggtggtcgaaggccgcatgttgcaggcactggacctgcaaccgggc
gaggacgtactggaaatcggcaccggcagtggctttgccaccgcctgcctggccgcactc
gcgcgcgaagtcctcagcctggagatcgacccggcgctggccgcggctgcgcgcgccaat
ctggaccgcaccggcctgggcagcaacgtccgtatcgaaaccgccgatgtcttcggctgg
cagagcgagcgtcgcttcgacgccatctgcgtgaccggcgcggtccacacgctgcccgtc
cagtggctgcagtggttgcgcccgaacggccggttgttcgtcgtgcgcggtcacgacccg
gtgatggaagcggtcctggtccgtggcgaggtcaacgccccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccaattctga

DBGET integrated database retrieval system