KEGG   Xanthomonas campestris pv. vesicatoria: XCV3641Help
Entry
XCV3641           CDS       T00288                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCV3641 (bcsZ)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCV3641 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4191299..4192480)
Genome map
AA seq 393 aa AA seqDB search
MSAHAHTGGMTRRRLLHAGALAGVAALLPAAARAAPSQCGPWPLWSAFVDKHIQPDGRVV
DFLNPDQRSTSEGQSYALFFALVNNDQVLFDKVLSWTRHNLCGGRPDLHLPAWLWGRDGG
SAWRVLDANTASDGELWIAYALLEAGRLWSRPGYLKAGQQMLQLIRTQEVATLPGLGPML
LPGRTGFVDNGRWTLNPSYLPIQVLRRCANADPKGPWAAIAANSARVLRDSAPVGFAPDW
TVWDGKTFNADPKRGNVGSYDAIRVYLWAGMLDAGEPLRARLLKDLSGPADLLAAQQTPA
EKIDTARGVGTGALPVGFSAALLPYLSALGKPALLKAQAQRVPAATQPAAAALPYFERTL
ALFGQGWLENRYRFAADGRLLPAWRTPACAATT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcacgcacataccggtggcatgacgcgccgtcgcctgctgcatgcaggcgca
ttggccggcgtggccgcgctgctgccggcagcagcgcgggcggcgcccagccagtgcggg
ccgtggccgctgtggagcgccttcgtcgacaagcacatccagcccgatgggcgggtggtg
gattttctcaatcccgatcaacgctccacctccgaagggcagtcgtatgcgctgttcttc
gcattggtcaacaacgaccaggtgctgttcgacaaggtgctgagctggacccgccacaac
ctgtgcggcggccgcccggatctccacctgccggcatggctgtggggccgcgatggcggc
agcgcctggcgcgtactggacgccaacaccgccagcgatggcgagttgtggattgcctat
gcgctgctggaagctggacggttgtggagccgcccgggctacctcaaggccggccagcag
atgctgcagctgatccgcacccaggaagtggccacgctacccgggctgggcccgatgctg
ctgccgggccgcaccggtttcgtcgacaacgggcgctggacgctcaatcccagctatctg
ccgatccaggtgctgcgtcgttgcgccaatgccgaccccaagggcccatgggctgccatt
gccgccaacagcgcgcgcgtgctgcgtgacagcgcgccggtggggtttgccccggattgg
acggtgtgggacggcaagaccttcaatgccgatcccaagcgcggcaatgtcggcagttac
gacgccatccgcgtgtacctgtgggccggcatgctggacgctggcgagccgctgcgcgcg
cgattgctgaaggacctgtccggaccggccgacctgctcgccgcgcagcagacgccggcc
gaaaagatcgacaccgcgcgcggtgtgggcaccggcgccctgccggtgggattttctgcg
gcgttgctgccgtacctgagcgcactgggcaagcctgcgctgctcaaggcgcaggcgcag
cgggtgcccgccgccacgcaaccggccgccgctgcattgccgtatttcgaacgcacgctg
gccctgttcggacagggatggcttgagaaccgctaccgcttcgccgcagacgggcgcctg
ttgcccgcctggagaacccctgcatgtgccgcaacgacctga

DBGET integrated database retrieval system