KEGG   Xanthomonas campestris pv. vesicatoria: XCV3675Help
Entry
XCV3675           CDS       T00288                                 

Gene name
dsbC
Definition
protein disulfide isomerase precursor (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCV3675 (dsbC)
Secretion system [BR:xcv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XCV3675 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4244409..4245206)
Genome map
AA seq 265 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTVDQRVSTALKALDPDFKP
DYIGAAPFPGFREVVVGGQVLYLSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTV
PKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDH
KEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGTQL
GGYLPPAQLREALEKRAVSTAGGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcgctgctgggcgcgatcagccttaccgcctgcgcacaa
tcctcgcagcctgcggcaagcactgccggcgccaagcccgccgccgcgcccgccgccacc
ggcacggtggaccagcgcgtgagcacggcgctcaaggcgctggacccggatttcaagccc
gattacatcggtgctgcgccgttccccggcttccgcgaagtggtcgtcggcgggcaggtg
ctatacctcagcgacgacggccgttacctgatccaggcgcagccgttcgacatccagaac
aagcagttcgccgccagcccgggcttgctggcctaccgccgcaagcagcttgacaccgtg
cccaaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtcaccgtcttc
accgatgtggaatgcggctactgccgcaagttgcatagcgagatcggcgagctcaacaag
cagggcatcgcggtggaatacctcgcgttcccgcgcatgggcctgggcagccaggaccat
aaggaaatgattgcggtgtggtgcgctgccgatcgcaagcaggcgctcaccgctgccaag
tcgggtcagccggtcgcctccaaggactgcaagaacccggtgtcgatggaatacaacctt
ggccagcgcctgggcgtcaacggaacgccggcgatcttcgcgcccgacggcacccagctc
ggtggctacctgccgccagcgcagttgcgtgaggcgctggaaaagcgtgccgtgagcacg
gcaggcggcagccgctga

DBGET integrated database retrieval system