KEGG   Xanthomonas campestris pv. vesicatoria: XCV3683Help
Entry
XCV3683           CDS       T00288                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XCV3683 (holC)
   00240 Pyrimidine metabolism
    XCV3683 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XCV3683 (holC)
   03430 Mismatch repair
    XCV3683 (holC)
   03440 Homologous recombination
    XCV3683 (holC)
Enzymes [BR:xcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XCV3683 (holC)
DNA replication proteins [BR:xcv03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XCV3683 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4252032..4252457
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLPTLILARDTQQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgacgccaacctgcccaccttgatcctggcc
cgcgatacgcagcaggccgaggcgctggacgacctgctgtgggcgttcgacgacgaagcc
tacgtgccgcaccagattgccggcaccgatgaggaagacgaactggccccggtgctgatt
gccgccccggagttcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccc
tatctgggcgcctgcgaccgcgtgctcgaagtggtgccggccgaccccgctgcccgcgaa
ccgctgcgcgaacgctggaaacagtacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system