KEGG   Xanthomonas campestris pv. vesicatoria: XCV3683Help
Entry
XCV3683           CDS       T00288                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xcv00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xcv00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:xcv03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:xcv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xcv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4252032..4252457
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLPTLILARDTQQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgacgccaacctgcccaccttgatcctggcc
cgcgatacgcagcaggccgaggcgctggacgacctgctgtgggcgttcgacgacgaagcc
tacgtgccgcaccagattgccggcaccgatgaggaagacgaactggccccggtgctgatt
gccgccccggagttcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccc
tatctgggcgcctgcgaccgcgtgctcgaagtggtgccggccgaccccgctgcccgcgaa
ccgctgcgcgaacgctggaaacagtacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system