KEGG   Xanthomonas campestris pv. vesicatoria: XCV3703Help
Entry
XCV3703           CDS       T00288                                 

Gene name
xanA
Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV3703 (xanA)
   00030 Pentose phosphate pathway
    XCV3703 (xanA)
   00051 Fructose and mannose metabolism
    XCV3703 (xanA)
   00052 Galactose metabolism
    XCV3703 (xanA)
   00500 Starch and sucrose metabolism
    XCV3703 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV3703 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XCV3703 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCV3703 (xanA)
Enzymes [BR:xcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XCV3703 (xanA)
    5.4.2.8  phosphomannomutase
     XCV3703 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4277704..4279050
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG
LRASGREVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT
GLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAG
LIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVRDNGADFGIAWDGDF
DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGQWRFNLRSSNTEP
LLRLNVETRGDAALLETRTQEISALLRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccgccttcaaggcctacgacattcgcggccgtgtgccggatgaactcaac
gaggacttggcccgccgcatcggcgtggcgctggcggcgcagctggatcaagggccggtg
gtcctgggccacgacgtgcgcctggccagcccggcgctgcaggaagcgctttcggcgggc
ctgcgcgccagtggccgtgaagtgatcgacatcggcctgtgcggcaccgaggaagtctat
ttccagaccgattacctcaaggcggccggcggcgtgatggtgaccgccagtcacaacccg
atggactacaacgggatgaagctggtccgcgagcaagcgcgaccgatcagctcggacacc
ggtctgttcgccatccgcgacacggtcgcggccgataccgcagcgccgggcgagcccacc
gccagtgagcagagccgcaccgacaagaccgcgtacctggagcacctgctcagctacgtg
gaccgcagcacgctcaagccgctcaagctggtggtcaatgccggcaatggcggcgccggt
ctgatcgtcgacctgcttgcgccgcatctgccgttcgaattcgtgcgcgtgttccatgag
cccgatggcaacttccccaacggcattcccaacccgctgctgccggaaaaccgtgacgcc
accgccaaggcggtcagggacaacggcgccgatttcggtatcgcgtgggacggcgacttc
gaccgttgtttcttcttcgatcacaccggccgcttcatcgaaggctattacctggttggc
ctgctggcacaagccatccttgccaagcagccgggcggcaaggtcgtgcacgacccgcgc
ctgacctggaacacggtcgagcaggtcgaagaagccggcggcattccggtgctgtgcaag
agcggccacgcctttatcaaggaaaagatgcgcagcgaaaatgccgtctacggcggcgag
atgagcgcgcaccactatttccgcgagttcgcctacgcagactccggcatgattccgtgg
ctgctgatcgccgaactggtgtcgcagtcgggccgttcgctggccgatctggtcgaagcg
cgcatgcagaaattcccctgcagcggcgagatcaacttcaaggtggccgatgccaaggcc
tctgttgcccgcgtgatggagcattacgcgtcgttgtcgccggagctggattacaccgac
ggcatcagcgccgattttggtcaatggcgtttcaacctacggagctccaataccgagccg
ctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgtacgcag
gaaatttccgccttgctgcgcggctga

DBGET integrated database retrieval system