KEGG   Xanthomonas campestris pv. vesicatoria: XCV3996Help
Entry
XCV3996           CDS       T00288                                 

Definition
disulphide-isomerase precursor (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCV3996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4586352..4587932
Genome map
AA seq 526 aa AA seqDB search
MTLSLPRPSPSLIALLAVLAALTACDKPAPPAAPAPPKTASTPAPVAGIAWREGDVEDAF
AEAKDSGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGER
FGVKAYPTIIVLRPDRREITRLAGNADNARLAEVLRVAAKSTSTAQQLLDKALHTPQQLS
ADDWAVLGNYAWGTDDTLVKPDAAADVLTRLSTSAPQPALQRSFALAAISAARHPPAASS
ANRTLLEAVLADPAEVRANLGTLNYVPARLVTAASNEAGERSTLSNALNQALDKVYADPS
LPISDRLGTAYARIQLARLAQGQPTETEAEGPQPPLPKDVVEVVHQRVQWATDTAKTDEE
RQSTISMAAALLSEVGDRSAAEQLLLAELSRSKTPYYYMPELADLAEQRGDKKTALLWLK
RAYDSAQGPATRVQWGVMYVDGLIRLSPDDSAGIEGAATQVIGELAGQPDGYRQRTRQRF
ATLGTALKTWSKQHRREGSAVLARLQQKMQSSCDSKATSECASWLS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtcgctgccacgcccttccccttccttgatcgcgctgctggcagtgctggct
gcgctgactgcctgcgacaagccagcaccgcctgcggcgcccgcaccacccaagacggcg
tccacgccggcacccgttgccggcatcgcctggcgcgagggcgacgtggaagacgccttt
gccgaagccaaggacagcggcaagccgatcctgttgtattggggcgcagcctggtgcccg
ccctgcaatcgcctcaaggccacgctgttcaaggatccggccttcatcgcgcgcacccag
cagttcgtcgccgtgcacctggacggcgattcggagggcgcgcaggcctggggcgagcgc
ttcggggtcaaggcgtatcccaccatcatcgtgctgcgcccggaccgcagggagatcacc
cggctggccggcaatgccgataacgcgcgcctggccgaggtgttgcgggttgcggccaag
agcaccagtaccgcccagcaattgctcgacaaggcgctgcacacaccacaacagctcagc
gcggacgattgggccgtgctcggcaactacgcctggggcaccgacgatacgctggtcaaa
cccgatgccgccgccgacgtgctcacccggctctccacctcggcgccacagccggcactg
caacgcagcttcgccctggccgccatcagtgccgccagacacccaccggctgccagcagc
gccaaccgcacgctgttggaagcggtgttggccgacccggcagaagtgcgcgccaatctc
ggcacgctgaactatgtgccggcacgcctggtcaccgccgccagcaacgaggccggcgag
cgcagcacgctctccaacgcactgaatcaggccttggacaaggtctacgccgatccttca
ttgccgatttccgaccggcttggcaccgcatacgcgcgcatccagctggcacgcctggca
caaggccagcccaccgaaaccgaagccgaaggcccgcaaccaccgttgccgaaagacgtg
gtggaggtggtgcaccagcgcgtgcagtgggccaccgacaccgccaagaccgacgaggag
cgccaatccaccatcagcatggccgccgcgttgctgagcgaggtgggcgatcgcagcgcg
gcagagcaattgctgctggccgagttgtcgcgcagcaaaacgccgtactactacatgccc
gaattggcggatctggccgaacaacgcggcgacaagaagaccgccctgttgtggctcaaa
cgggcctacgacagcgcgcaaggtcccgccacacgcgtgcagtggggcgtgatgtacgtg
gatgggctcatccggctcagccccgacgacagcgccggcatcgagggcgccgccacccag
gtgatcggcgagttggccggtcaaccggatggttaccggcaacggacccgtcagcgcttc
gccacccttggcaccgcattgaagacctggagcaagcagcatcgccgcgaaggcagcgca
gtgctggcgcgtctgcaacagaaaatgcagtccagctgcgacagcaaagctaccagcgag
tgcgccagttggctgagttga

DBGET integrated database retrieval system