KEGG   Xanthomonas campestris pv. vesicatoria: XCV4025Help
Entry
XCV4025           CDS       T00288                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV4025 (manB)
   00030 Pentose phosphate pathway
    XCV4025 (manB)
   00051 Fructose and mannose metabolism
    XCV4025 (manB)
   00052 Galactose metabolism
    XCV4025 (manB)
   00500 Starch and sucrose metabolism
    XCV4025 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    XCV4025 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    XCV4025 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCV4025 (manB)
Enzymes [BR:xcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XCV4025 (manB)
    5.4.2.8  phosphomannomutase
     XCV4025 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4621195..4623540)
Genome map
AA seq 781 aa AA seqDB search
MSKANERRQGMSSVRTSGPVLGGMLLLLAAWFGWNSYAQWRQDAVAQGLEQARDRAVQDV
GQAMATQASQLDAVLKQPPVIAALAGGDALAAASAIRERFKGAEDVQVLPGDLAAAYANP
KDFGYARLSLLESAQVADRAQVRVVREAKQVRLGVAAAVRLGGQPAVAYARLPLLRLTGP
LDAIAAPDSAYLAVRQGSYNVAQQGDMALADAAETLARPLGTSGLRVAAAVPQGDSGPLG
LGAVGCAIVAALLLIIAVLLVLASRGQVALPRRRVADQSGADEPTFSQSLQHDASVASEA
RALDAEAPPAPPALVPAVQVATEMFRAYDIRGVVGKDLNPGVAALVGQAIGSVMQAQGLR
DVVVGRDGRLSGPELSNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSH
NPPDYNGFKIVIGGETLSGAAIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIADDV
QLDRPIKVVVDAGNGVAGEIAPRLLEAIGAEVVPLYCDIDGTFPNHHPDPSEPHNLNDLV
KMVQRFDADIGVAFDGDADRLGVVTKEGAMVFPDRLLMLFAADVLQRNPGALVIYDVKCT
GKLSDYVLRNGGSPLMWKTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAA
RLLEILAQREETPSDVLDALPESVSTPEIKVPVEGDAHALVARFVARAQTGEESPFESAR
LSTIDGLRADFIDGWGLVRASNTTPILVLRFEADSEAALQRIRTLFRNELQTLLPEHPLA
F
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgaacgagcgcaggcaggggatgtccagcgtgcgtacgagtggtccggtg
ttgggaggcatgttgctgctgctggctgcctggttcggctggaacagttatgcgcaatgg
cgccaggacgcggtggcgcaagggctggagcaggcgcgcgaccgcgcggtgcaggacgtg
ggccaggccatggccacccaggccagccagctcgacgcggtgctcaagcagccgccggtc
atcgctgcgttggccggtggcgacgcgctggcggccgcatcggccatccgcgagcgcttc
aagggcgccgaggatgtgcaggtgctgcctggcgaccttgccgcggcctatgccaacccc
aaggatttcggttacgcgcgtctgagcctgctcgaatcggcgcaggtggccgaccgggcg
caggtccgggtggtacgcgaggccaaacaagtccgcctgggcgtggctgccgcggtgcgc
cttggcgggcagccggcggtggcgtatgcgcggttgccgttactgcgcctgaccggcccg
ctggatgcaatcgcggcaccggacagcgcctacctggccgtgcgccagggcagctacaac
gtggcccagcagggcgatatggcactggccgatgcggccgaaacgctggcaaggccgctt
gggaccagcggcttgcgcgtggctgcggcggtgccgcaaggcgacagcggcccactgggc
ctgggcgccgtcggttgcgccatcgtggcggcattgctgctgatcattgcggtactgctg
gtgctggccagccggggtcaggtggccttgccacggcgccgggttgccgaccaatccggc
gccgatgaacccaccttcagtcagagcctgcagcacgacgccagcgttgccagcgaggca
cgcgcgctggacgccgaggcaccgccggcaccgccagcgctggtgccggcggtgcaggtc
gccaccgagatgttccgtgcctacgacatccgcggcgtggtcggtaaggacctcaacccc
ggcgttgccgccttggtgggccaggccatcggcagcgtgatgcaggcgcagggactgcgc
gatgtggtggtcggtcgcgacggccggctgtccgggccggagctgagcaacggcctgatc
gaaggcctgcgccgcgccggctgcaacgtcaccgacatcggcctggcaccgacgccggtg
gtgtacttcggcgcctacgagctgcgtgccggcagctgcgtggcggtcaccggcagccac
aatccgccggactacaacggtttcaagatcgtgatcggcggcgagaccttgtccggcgcc
gccatcgccgaactgcaccagcgcatcaacgaaggtcgcctgcataccgccgccacgcct
ggcgaactggaacagcgcgacatcagcgatgcctacatccagcgtatcgccgatgacgtc
cagctcgatcgcccgatcaaggtggtggtggacgccggcaacggcgtggccggtgagatc
gcgccgcgcctgctggaagcgatcggcgccgaagtggtgccgttgtactgcgacatcgat
ggcaccttccccaaccatcaccctgatccgagcgagccgcacaacctcaacgatctggtg
aagatggtgcagcgtttcgatgcggatatcggcgtggcgttcgatggcgatgccgatcgc
ctgggcgtggtgaccaaggaaggcgcgatggtgttccccgaccgcctgctgatgctgttc
gccgccgatgtcctgcagcgcaaccctggcgcattggtcatctacgacgtgaagtgcacc
ggcaagctgtccgactacgtgttgcgcaatggcggtagtccgctgatgtggaagaccggg
cattcgctgatcaaatccaagatgcgcgagaccgatgctgagctggccggcgagatgagc
ggccacttcttcttcaaggagcgctggtacggctttgacgacggcatctacgccgccgca
cgcctgctggaaatcctggcccagcgcgaggaaaccccgtccgacgtgctggacgccctg
cccgagagcgtctccacgccggagatcaaggtgccggtggaaggcgatgcgcatgcgctg
gtggcgcgctttgtcgcgcgtgcgcagaccggcgaagaatcgccgttcgaatcggcgcgg
ctgtcgaccatcgacgggctgcgcgcggacttcatcgacggctgggggctggtacgcgcc
tccaatacaacgccgatcctggtgctgcggttcgaagccgacagcgaggccgcattgcag
cggattcgcacgctgttccgcaacgaactgcagacgttgttgccggagcatccattggcg
ttttga

DBGET integrated database retrieval system