KEGG   Xanthomonas campestris pv. vesicatoria: XCV4266Help
Entry
XCV4266           CDS       T00288                                 

Gene name
phoD2
Definition
alkaline phosphatase precursor (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcv00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xcv00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4900442..4902013
Genome map
AA seq 523 aa AA seqDB search
MTVSDPARRRILQGLGAGVLLPATAGWSARSLAAPSGRPTITDGVQSGDVLDDRAMLWSR
ADRPARLRVEWDTRPSLRQARRVDGTIASAAHDFTARADLRGLPRDQDIFYRVRFEDADS
GVLSAPVHGHLRSAPQARGDVRFVWSGDTVGQGFGINPDIGGMRIYSAMRERNPDFFLHS
GDTIYADSPIPAELTVEDGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDAHVRRFNAEV
PQLWQWDDHETTNNWSPGKQLDARYQVRDIDVLARRARQAFLEYAPMRGVRADGSGRIYR
KIAYGPLLDVFVLDMRSYRGANSDNLQPRPGPDAAFLGPEQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGEDGNGRPRWEAIANGDPGVPRGREQEIATLLRFISRARIRNTVWLTAD
VHYCAAHYYHPDRAAFQQFEPFWEFVGGPLNAGSFGPNALDATFGPSVVFQKAPPAPNTS
PLAGYQFFGEVDIDGRSGVLTVTLRDLDGVAQFRQPILPHGVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactgtctccgatcccgcccgtcgccgcatcctgcaaggcttgggtgccggcgtgttg
ctgccggccactgccggttggtcagcgcgcagcctggccgcgccgtcgggacgacccacc
atcaccgacggggtgcagagcggcgatgtgctggacgaccgcgcgatgctgtggagccgt
gccgatcgcccggcgcggttgcgggtggaatgggacacccgcccaagcctgcgtcaggcg
cggcgcgtggacggcacgatcgcatcggcggcgcacgacttcaccgcacgtgcggacctg
cgcggcctgccacgcgaccaggacatcttctatcgcgtgcgtttcgaagatgccgacagc
ggtgtgttgagcgcgcccgtccacggccatctgcgcagtgcaccgcaggcgcgtggcgat
gtgcgctttgtctggagcggcgacacggttggccagggcttcggcatcaacccggacatc
ggcggcatgcgcatctactcggcgatgcgcgagcgcaatccggatttcttcctgcacagc
ggcgacaccatctacgccgacagcccgatcccggccgagctgacggtggaagacggcaag
cgctggcgcaatctcaccaccgcggccaaaagcaaggtggccgaaacgctggacgaattt
cgcggcaactatcgctacaacctgctcgatgcgcacgtgcgccgcttcaatgccgaggtg
ccgcaactgtggcaatgggacgaccacgaaaccaccaacaattggtcgcccggcaagcaa
ctggatgcgcgctatcaggtgcgcgacatcgacgtgctggccaggcgcgcccgccaggcg
tttctggaatacgcgccgatgcgcggcgtgcgcgccgacggcagcgggcgtatctaccgc
aagattgcctacggcccgttgctggatgtgttcgtgctggacatgcgcagctaccgcggc
gccaacagcgacaacctgcaaccgcggcccggtcccgatgccgcgtttctcgggccggag
caactggcgtggttgcagcgcgaactggccggctcgcgcgcgcaatggaaggtgattgcc
gccgacatgccgatcggcctgcaggtgccagatggcgaagatggaaacgggcgcccgcgc
tgggaggcgattgccaatggcgaccccggcgtgccacgtggccgcgaacaggaaatcgcc
acgctgttgcgcttcatcagccgcgcacgcatccgcaatacggtgtggctcaccgccgac
gtgcattactgcgcggcgcactactatcaccccgatcgcgccgcatttcagcagttcgaa
ccgttctgggaatttgtcggcggcccgctcaatgccggcagtttcgggcccaatgcactg
gatgccacgttcggcccgagcgtggtgtttcaaaaagcgccacctgcgcccaacacctcg
ccgctggccggttaccagttctttggcgaagtggacattgatggccgcagcggcgtcctc
acggtgacgttgcgcgacctggatggggtggcgcagttccgtcaaccgattctgccgcac
ggcgtggcttag

DBGET integrated database retrieval system