KEGG   Xanthomonas campestris pv. vesicatoria: XCV4275Help
Entry
XCV4275           CDS       T00288                                 

Gene name
acsA
Definition
(GenBank) acetyl coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00620  Pyruvate metabolism
xcv00640  Propanoate metabolism
xcv00680  Methane metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01130  Biosynthesis of antibiotics
xcv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV4275 (acsA)
   00620 Pyruvate metabolism
    XCV4275 (acsA)
   00640 Propanoate metabolism
    XCV4275 (acsA)
  Energy metabolism
   00680 Methane metabolism
    XCV4275 (acsA)
Enzymes [BR:xcv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XCV4275 (acsA)
Lipid biosynthesis proteins [BR:xcv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XCV4275 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAJ26006
UniProt: Q3BMK7
Position
4908705..4910723
Genome map
AA seq 672 aa AA seqDB search
MRHTDCLPRAAATPSSDKFIASEGAMADVYPVDPAFAADARVTREQYAALYRESIEHPEQ
FWGKAAQRLEWFKQPTQIKDVSYALDDFHIRWFGDGELNASVNCLDRQLATRGDKTALLF
EPDSPDAASYPVTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIG
AVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANVDAALKIPGTDTVET
VLVVRHTGGAVEMQAPRDRWFHDVVDGQPAECTPERMNAEDPLFILYTSGSTGKPKGVLH
TTAGYLLFASYTHEVVFDLREDDIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNY
PNVSRFWEVIDKHQVTIFYTAPTAIRALMRDGAEPVKKTSRKSLRLLGSVGEPINPEAWR
WYYEVVGDSRCPIVDTWWQTETGGILISPLAGAVDLKPGSATLPFFGVQPALVDAEGKIL
EGATEGNLVLLDSWPGQMRSVYGDHQRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRV
DDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGQSPSEDLH
KELVSWVRKEIGPIASPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPS
VVDSLVNERLAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacactgattgtctaccgagggcagccgcaacgccctcttccgacaagttcatc
gcaagtgagggtgccatggctgatgtttatcccgtcgatcccgcgttcgccgccgatgcg
cgcgtgacgcgcgagcagtacgccgcgctgtaccgcgaatcgatcgaacaccccgaacag
ttctggggcaaggccgcgcagcggctcgaatggttcaagcaacccacccagatcaaggac
gtcagctacgcgctggacgacttccatatccgctggttcggcgatggcgagctcaacgcc
agcgtcaactgcctggaccgccagctggccacacgcggcgacaagaccgcactgctgttc
gaacccgacagcccggatgcggcctcctacccggtcacctaccgcgagttgtacgagcgc
gtctgcaagctgggcaatgcgctgcgcaacctgggcgtcaagaagggcgaccgggtcacc
atctatctgccgatgatcgtcgacgccgctgtggccatgctcgcctgcgcgcgtatcggt
gcggtgcattcggtggtgttcggcggctttgccgccaactcgatcgccgaccgcgtgatc
gattgccagagcaagctgatcatcaccgccgatgaaggcctgcgcggcggcaagaagatt
ccgctcaaggcaaatgtcgatgcagcgctgaagattcccggcaccgatacggtggaaacc
gtgctggtggtgcgccataccggtggcgcagtggagatgcaggcaccgcgcgatcgctgg
ttccacgatgtggtcgacggccagccggccgagtgcacacccgagcgcatgaacgccgaa
gacccgctcttcatcctctacacctccggctccaccggcaaacccaagggcgtgttgcac
accaccgccggctatctgttgtttgccagctacacgcatgaagtggtgttcgacctgcgc
gaggacgacatctactggtgcaccgccgacgtgggctgggtcaccggccacagctacatc
gtctatggcccgctcgccaatggcgccaccgcggtgatgttcgaaggcgtgcccaattac
ccgaacgtgtcgcgcttctgggaagtgatcgacaagcatcaggtcaccattttctacacc
gcacccaccgcgattcgcgcgctgatgcgcgacggtgcggaaccggtcaaaaagacctcg
cgcaagagcctgcgcctgcttggcagcgttggcgagccgatcaatccggaagcctggcgc
tggtattacgaggtggtcggtgacagccgttgcccgatcgtggatacgtggtggcagacc
gaaaccggcggcatcctgatttcgccgctggccggcgcggtcgatctcaaaccgggctcg
gccaccttgccgttcttcggcgtgcagccggcgctggtcgatgccgaaggcaagattctg
gaaggcgccaccgaaggcaatctggtgctgctcgattcctggccgggccagatgcgtagc
gtgtacggcgaccaccagcgtttcatcgacacctacttccgcacctatccgggcagctac
ttcaccggcgacggctgccgtcgcgatgccgacggctactactggatcaccggccgcgtg
gacgatgtgatcaatgtttccgggcaccgcatcggcaccgccgaagtggaaagcgcgctg
gtttcgcaccccaaggtcgccgaagcggccgtggtgggcttcccgcatgacgtcaagggc
cagggcatctatgcctacgtcaccctgatcgccgggcagagcccgagcgaagacctgcac
aaggaattggtcagctgggtgcgcaaggagatcggcccgatcgcctcgcccgatcacctg
cagtgggcgcccggcctgcccaaaacccgctcgggcaagatcatgcgccgcatcctgcgc
aagatcgccgagaacgcgcccgaccagctcggcgacacctccacgctggcagatccgtcg
gtagtggattcgctggtcaacgagcgcctggcgcgctga

DBGET integrated database retrieval system