KEGG   Xanthomonas campestris pv. vesicatoria: XCV4349Help
Entry
XCV4349           CDS       T00288                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XCV4349
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XCV4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5001364..5002044)
Genome map
AA seq 226 aa AA seqDB search
MFALEQRQRVVALCIELSRRGYLAGTGGNVALRIDAECFAVTPSAIDYLSMQAEDICIVR
TKDLHQLDGTRTPSVETGLHAQVMRRRPDVGCSIHTHQPVASACTLLGAPLEVTQPALRR
LLGARIPIAGYMPSGTGLLARLLARQLQPTVNAYLLRNHGVVCCGTNLEAAVTVVEALEL
AARSHLQTQIQARAAREPDLAAGLLRVLTALDSSRHTSGASSLSQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccttgaacaacgccagcgcgtggtcgcgctgtgcatcgaactgtcgcgccgc
ggctatctggccggcaccggcggcaatgtcgccttgcgtatcgatgccgagtgtttcgcg
gtcactccctcggcgatcgactacctgagcatgcaggccgaggatatctgcatcgtccgc
accaaggacctgcaccagctcgacggcacgcgcacgccgtcggtcgaaaccggcctgcat
gcgcaggtgatgcggcggcgcccggacgtgggttgcagcatccacacccaccagccggtc
gccagcgcctgcaccctgctgggcgcgccgttggaggtgacgcaaccggcgttgcgccgg
ctgcttggtgcacggattccgatcgccggctacatgccgtcgggcaccggcctgctggcc
cgcctgctggcccggcagctgcagcccaccgtcaacgcctatctgctgcgcaatcacggc
gtggtctgctgcggcaccaacctggaggcggccgtcaccgtggtcgaagcgttggagctg
gccgcgcgcagccacctgcagacgcagatccaggcgcgtgcggcgcgcgagcccgacctc
gctgccggcctgctgcgggtgctgacggcgctggattccagccggcacacgtccggcgcg
tcctccctttcccagacatga

DBGET integrated database retrieval system