KEGG   Xanthomonas campestris pv. vesicatoria: XCV4356Help
Entry
XCV4356           CDS       T00288                                 

Gene name
bga2
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcv00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xcv00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xcv00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5008114..5010885)
Genome map
AA seq 923 aa AA seqDB search
MRAHAKHNVTRALRAGYAVRACTGLFWLCSAWPIIAAPHAASDASRERISLDAQWRFHRG
DPPANQEILDYDVRPQVVRSSDGRVADAQPEQAQLIDAPAVRVLKPWILPTANGLIADPA
QRHIRPPGNPGSTVAYVQPHFDDSAWETVDLPHDWAIAGPFLADGPYGGMGRLPSWGIGW
YRKSLDIPASDRGRAMFLDLDGAMSYATVWLNGKLVGGWPYGYSSWRVDLTPYAIAGKRN
QLVIRLDNPPESARWYPGGGLYRNVWLTKAAPLHIAHWGTQLTTPYVSADAAQVQLTVTL
DNAARSATQAQVRTAIYLLDDASDRPSGEAVARIPAQPISVPAGGTAQVQGSTRIDAPRL
WGPPPTQHPHRYVAVTEVDQQGRVVDRYETRFGIRSIVFDADKGLLVNGEHVPIRGVNNH
HDLGALGAAFNRRAAERQLQLLQQMGANAIRMSHNPPAPELLDLTDRMGLLVVDEVFDSW
EMKKTPLDFHLVFPQWHAADLRAMLRRDRNHPSVMLWSVGNEVGEQYTGQQGAAIARTLR
AIVHAEDPTRPATVAMNYASPEMPLPAALDVVSLNYQGEGIRDAAEFEGTERIRKPPQYP
AFHARFPHKAIVSSETASALSSRGVYLFPVTADNSAPVRDGRGGDSVAHQVSAYELHAVD
FGSSADKVFAALDQHPYVAGEFVWTGFDYLGEPTPYYSSRSSYSGIFDLAGFPKDRYWLY
QSRWRPELPVAHLLPHWSWPGREGQVTPVHVFTSGDEAELFVNGVSQGRKRKAPRQYRLR
WDAVVYQPGELRVQAYKDGKPWASERVQTAGRAARMQLTPDRCSIRGDGQDLSFITVRLL
DRDGRPAPTAGDRLRFRIEGPGELVATDNGDPTNLETFAASQRHAFNGLCLAIVRAKAGA
RGTITVHVESDTLQAAQTQVAVQ
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacacgccaagcacaacgtcacacgagcgctgcgcgcaggttatgcagtacgt
gcctgcacggggcttttctggctctgcagtgcatggcccatcatcgcagcaccgcacgct
gccagcgacgcctcgcgcgaacgtatttcgctggatgcgcagtggcgctttcatcgtggc
gacccacccgcaaaccaggaaatcctggactacgatgtgcgcccgcaggtggtgcgcagc
agcgatggcagggtggccgatgcgcagccggaacaagcgcagctcatcgatgcgcccgcc
gtgcgcgtgctcaagccgtggatcctgcccaccgccaacggtttgatcgcagacccggcc
caacggcacatacgccctccaggcaatccgggcagcacggtggcgtatgtgcagccgcac
ttcgacgacagcgcatgggaaaccgtggacctgccgcatgactgggccattgccgggccg
ttcctggcagatgggccttacggtggcatgggtcggttgccgagctggggcatcggctgg
tatcgcaagagcctggacatcccggccagcgatcgcggccgcgcgatgtttctggatctc
gatggtgcgatgtcttacgccacggtctggctcaacggcaagcttgtcggcggctggccg
tacggttacagctcctggcgcgtggatctgacgccgtatgcgattgcaggcaagcgcaat
cagctggtcattcgcctggataacccgcccgagtcggcgcgttggtatccaggcggtggg
ctgtatcgcaacgtgtggctgaccaaagcggcgccgttgcatatcgcgcactggggcacg
cagctgaccacgccgtacgtctcggccgatgcggcgcaggtgcagctgaccgtcaccttg
gacaacgccgcccgcagcgcaacccaggcgcaggtgcgcacagcgatttatctgctcgac
gatgcaagcgaccggcccagtggcgaagcggtcgcgcgcattcccgcgcagcccatcagt
gtccctgccggcggcacggcgcaggtgcaaggcagcacccggatcgatgccccgcgcctg
tgggggcctccacccacccagcacccgcatcgctatgtggccgtcaccgaggtcgaccaa
cagggacgcgtggtggaccgctacgaaacccgcttcggcattcgcagcatcgtgttcgac
gccgacaagggcctactggtcaacggcgagcacgtgccgatccgcggggtgaacaatcat
cacgacctgggcgcgctcggtgcagcgttcaacaggcgcgccgccgagcgacagttgcaa
ttgctgcagcagatgggcgccaacgccatccgcatgagccataacccgcctgcgcccgaa
ttgctcgatctgaccgaccgcatgggtctgctggtggtggatgaggtgttcgacagttgg
gagatgaagaagaccccgctggactttcatctggtgtttccgcagtggcatgccgccgat
ctgcgcgcgatgctgcgccgcgaccgcaaccacccctcggtgatgctgtggagcgtgggc
aacgaggttggcgagcaatacaccggccaacagggcgcggcgattgcgcgcacgctgcgc
gccatcgtgcatgcagaagacccgacgcgcccggccacggtggcgatgaactacgcctcg
cccgagatgccgctgcccgctgcgctggatgtcgtcagcctcaattaccagggcgaaggc
atccgcgatgcagccgagttcgagggtaccgagcgcatccgtaaaccgccgcaatacccc
gcgttccatgcacggtttccacacaaggccattgtcagcagcgagactgcctcggcactg
agcagtcgtggcgtgtacctgtttccggtcactgcggacaacagcgcaccggtacgcgat
ggccgtggcggcgattcggtggcgcatcaggtcagcgcgtacgaactgcatgcggtggac
tttggctccagcgcggacaaggtgttcgctgcgttggatcaacacccttacgtggccggt
gagttcgtctggaccgggttcgattacctgggcgagcccaccccgtattacagctcgcgc
agttcctactcgggcatcttcgatctggccggcttcccgaaggaccgttactggctctat
cagtcgcgctggcgtccggaactgccggtggcgcatctgctgccgcattggagctggcca
gggcgcgaaggacaggtcacgcccgtgcatgtgttcacctccggcgacgaggccgaactc
ttcgtcaacggcgtttcgcaggggcgcaagcgcaaggcgccacggcagtaccggctacgc
tgggacgcggtggtgtaccagccgggcgaattgcgggtgcaggcgtacaaggacggcaag
ccgtgggccagcgagcgcgtgcagacggcaggccgcgccgcgcgcatgcagctgacgccg
gatcggtgcagtatccgcggcgacggacaagacctgagcttcatcaccgtgcgcctgctc
gatcgcgacggacgtcccgcaccgaccgcgggcgaccgcctgcgcttccgcatcgaaggc
cctggcgagttggtggccaccgacaacggcgaccccaccaatctggaaacgttcgctgcg
tcgcaacgtcatgccttcaatgggctgtgcctggcgatcgtgcgtgccaaggccggggcg
cgtggcacgatcaccgtgcatgtggaatcggacacgttgcaagccgcacagacccaggtg
gcggtgcagtga

DBGET integrated database retrieval system