KEGG   Xanthomonas campestris pv. vesicatoria: XCV4358Help
Entry
XCV4358           CDS       T00288                                 

Gene name
xynB2
Definition
xylanase precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XCV4358 (xynB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5012429..5013406)
Genome map
AA seq 325 aa AA seqDB search
MLKLRYPLTLVLLLGAYASAVAGPIAAGKQRVLGSAYSPQQAQGFTNYWNADVPENAGKW
GSVEPVRGQMNWGPLDEAYQLAKRNHMQFQFHVGLWGAQQPTWVRNLPPNEQLAAIEHWF
AAIAQRYPDIDLMQVANETLPGHNQPDNRRSDTGNYLRALGGTGATGVDWVLEAFRLARK
YFPHTKLMINDYNVTEYNDQARQYLHTIQLLQQEHLIDAIGIQGHLSSNGPSVSVQRANL
DLLASTGLPIYITEFDLDGRTDAQQLAAWQRFFPMFWEHPAVRGVNVWGFRHGLWRENEG
AYLINYDGSERPALTWLRSYVASRP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactccgttatccgctcacgcttgtgctgttgctgggcgcgtatgcgtccgct
gttgccgggcccatcgctgccggcaagcagcgcgtcctgggcagcgcctacagcccacag
caagcgcagggcttcaccaactactggaacgccgacgtgcccgaaaatgcgggcaaatgg
ggcagcgtcgagcccgtgcgcggccagatgaactggggcccgctcgacgaggcttaccag
ttggccaagcgcaaccacatgcaattccagttccatgtcgggctctggggtgcccagcag
ccgacgtgggtgcgcaacctgccgccaaacgagcagcttgcggcgatcgagcactggttt
gccgcgattgcgcagcgctaccccgacatcgacttgatgcaggtggccaacgagacgctg
ccgggtcacaaccagccggacaatcgccgcagcgatacgggcaactatctgcgggcactg
ggcggcaccggggcgaccggcgtggactgggtgcttgaggcattccgcctggcacgcaag
tatttcccccataccaagttgatgatcaacgactacaacgtcaccgagtacaacgaccaa
gccaggcagtatctgcacaccatccagctgctgcagcaagaacacctgatcgatgcgatc
ggcatccaggggcacctgtcgagcaacggcccctcagtttcggtgcagcgcgccaacctc
gacctgttggcgtccaccggactgccgatctacataaccgagttcgacctggatgggcgt
accgacgctcagcagttggcagcctggcagcgtttcttcccgatgttctgggagcatccg
gccgtgcgtggcgtgaacgtgtggggtttccgtcacggtctatggcgtgaaaatgaaggt
gcgtatctgatcaattacgacggcagcgaacgcccggccttgacctggctacgcagctac
gttgccagcaggccctga

DBGET integrated database retrieval system