KEGG   Xanthomonas campestris pv. vesicatoria: XCV4378Help
Entry
XCV4378           CDS       T00288                                 

Gene name
pyrF
Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    XCV4378 (pyrF)
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     XCV4378 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5040788..5041519)
Genome map
AA seq 243 aa AA seqDB search
MSRAPLPLAAHERLIFALDVPGHDEAIAWVDRLGDSVSFYKIGMELLASGEYFHVLDALA
KRDKRVFVDLKFFDIPATVAGTIRRLAQWPVSYCTVHGWHAGMLQAAAEANHGDMRLLAV
TVLTSMGRPDLAAMGIDREPVDVVVERALAAQAAGIDGVIASGQEAGPIRRATGPDFSIV
CPGIRPGGPVGDDQQRTVGVAQAFTDGADAIVVGRPIRQASDPAAAATAIQDEIRAALPQ
NGN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcgcccttgccgctggccgcgcatgagcggctgatcttcgcgctggatgtg
cccggccacgatgaagcgatcgcctgggtggaccggctcggcgattcggtgtcgttctac
aagatcggcatggagctgctggcatcgggcgagtacttccacgtgctcgatgcgctggcc
aagcgcgacaagcgcgtgttcgtggacctcaagttcttcgacattcccgccaccgtggcc
ggcaccatccgccgcctggcgcagtggccggtgagttattgcacggtgcacggctggcac
gccggcatgctgcaggccgccgccgaggccaatcacggtgacatgcgcctgctggcggtc
acggtactgacgtcgatgggccgcccggacctggcggcaatgggcatcgaccgtgaaccg
gtggacgtggtggtggaacgcgcgctggctgcgcaggccgccgggatcgatggcgtgatc
gcttcggggcaggaagccggcccgatccgccgcgccactggcccggacttttcgatcgtc
tgccccggcatccgccccggcggcccggtcggcgacgaccagcaacgcacggtcggcgtg
gcgcaggccttcaccgacggcgccgacgcgatcgtcgttggccgcccgatccgccaggcg
agcgaccctgcagccgctgccaccgccatccaggacgagatccgcgcggcactgccgcag
aacggaaactga

DBGET integrated database retrieval system