KEGG   Xanthomonas campestris pv. vesicatoria: XCV4441Help
Entry
XCV4441           CDS       T00288                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xcv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5116103..5118478)
Genome map
AA seq 791 aa AA seqDB search
MTHPNLLAALNQSGALRTLDLAFAQSLQRLEPDTDPQMLAGAALASLAVTSGHAGLDPAR
AAMLLDARDGPPPTFPDPADWQRSLAASRWVDQPQPDAPAAADCPLVLERGLLYLRRYRE
YERRLALGLQRIAAQPLPPVDAATLAPLFAQLFPNAIPTPRTAEPTPLPPGEGARRAGEG
TGLPAPIHYQEGTTPPTPSHPPDRQAQAAALALRRALLLVTGGPGTGKTTTIARLLLLRI
AQARASSTPAPRIALAAPTGRAAERMAESLRAAIARAIADGIQLPAAGSLPAPSGSAGLI
TSTHPTNAAAPASTGAGLELQTHAASEQGGPPSWEALLPSGASTLHRLLGVIPDSPHFHH
NADNPLPFDLIVVDEASMVDLPLMCKLVDAVADGTQLILLGDADQLPSVEAGDVLAAILQ
AAGPGDALQPEDAQALQSLLGSAPVERPPAVTSATRSGGLDGHRVHLLRGYRQAQDFALA
PLADAIRAGDADTALALLRSGELPGVHFHEDGEDPLALGRDALLAHWRALANAQDPAAAL
RDAGRLRLLTAVRAGPQGARGLNARIEQLLADTGSGARRLGGASPWFQGRLLLITENSYR
HGLFNGDVGICLRSDAGPSPGQGDASAVTARGHAAPSSRPGHAGDSARHDAPATDRRAQG
PLVAWFEGDGDGQVRGFHPAALPAHESAFAMTVHKAQGSEFDEVWLQLPTRDARVLSREL
LYTGITRARRALHLAASEAVMRAALARHAARISGLAWRLGAKDDKPPPVPAPTPAPLPQP
PPSAPVQGALF
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgacccatccaaacctgctcgccgccctcaaccagagcggcgccctgcgcaccttggat
ctggccttcgcgcaaagcctgcaacgcctggagccggacaccgacccacagatgctggcc
ggcgccgcgctcgcctcgctggcggtcaccagcggccacgccggcctggaccccgcccgc
gccgccatgttgctggacgcgcgcgacggcccgccgcccaccttcccggaccccgccgac
tggcaacgcagcctggccgcctcgcgctgggtcgaccaaccgcagcccgacgccccggcc
gccgccgattgcccgctcgtcctcgaacgcggcctgctctacctgcgccgctaccgcgag
tacgaacgccgcctggccctgggcctgcaacgcatcgccgcgcaaccgctgccgccggtc
gacgccgccacgctggcgccgctgttcgcgcagttgttcccgaacgcgatcccaacccct
cgcaccgcggagccaacccctctccccccgggagagggtgcccgacgggcgggtgagggt
acgggcctgcccgcgccaatccactaccaagagggaacaaccccccccacgccatcccac
cccccggaccgccaggcccaggccgccgcactcgcgctacgccgcgcgttactgctggtc
accggcggcccgggcaccggcaagaccaccaccatcgcccgcctgctgttgctgcgcatc
gcccaggcacgggcatccagcacgccggccccacgcatcgccctggccgcgcccaccggc
cgcgccgccgagcgcatggccgaaagcctgcgcgccgccatcgcgcgtgccatcgccgac
ggcatccagctcccggccgccggctcgcttcccgcaccatcgggaagcgccggcctcatc
acgtccacgcatccgaccaacgccgccgcgcccgcgtccaccggcgccggattggaactg
cagacgcatgccgcctcagagcagggcgggccgcccagctgggaagcgctgctgcccagc
ggcgccagtaccctgcatcgtctgctcggcgtcatcccggattccccgcacttccaccac
aacgccgacaacccgctgccgttcgacctgatcgtcgtcgacgaagcctccatggtcgac
ctgccgctgatgtgcaaactggtcgacgccgtcgccgatggcacccagctgatcctgctt
ggcgatgccgaccagctgccttcggtggaagccggcgacgtgctggccgccatcctgcag
gccgccggcccgggcgatgccctgcagcccgaagacgcccaggcactgcaatcgctgctc
ggcagcgcgcccgtcgagcgtccgcctgcggtcacctccgccacccgcagcggcggcctg
gacggccaccgcgtgcacctgctgcgcggctatcgccaggcgcaggatttcgcactggcg
ccactggccgacgccatccgcgccggcgatgccgacaccgccctggccctgctgcgcagc
ggcgaactgcccggcgtgcacttccacgaagacggcgaagatccgctggcactcggccgc
gacgcgctgctcgcgcactggcgcgcgctggccaacgcccaggaccccgccgccgccctg
cgcgatgccggccgcctgcgcctgctcaccgcggtgcgtgccggcccgcaaggcgcacgc
ggcctcaacgcccgcatcgaacaactgctcgccgacaccggctccggcgcccgccgtctg
ggcggcgcctcgccctggttccagggccgcctgctgctgatcaccgaaaacagctatcgc
cacggcctgttcaatggcgatgtcggtatctgcctgcgcagcgacgcgggcccttccccc
gggcagggcgacgcaagtgccgtgaccgcgcgcggccacgcggcaccgtcgtcaaggccg
ggccacgctggcgacagcgcacgccatgacgcccccgccaccgaccgccgtgcccaaggc
cccttggtcgcctggttcgaaggcgacggcgacggccaggtgcgcggcttccaccccgcc
gcactgcccgcgcacgaaagcgccttcgccatgaccgtgcacaaggcccagggcagcgaa
ttcgacgaggtctggctgcaactgcccacccgcgacgcccgcgtactcagccgcgaactg
ctctacaccggcatcacccgcgcccgccgcgccctgcacctggccgccagcgaagcggtc
atgcgcgccgcactggcacgccacgccgcgcggatctcgggcttggcgtggcggttgggt
gcaaaagacgacaagccaccgccggttccagcacccacgccagcgccgcttccacaaccg
ccgcccagtgcgcctgtgcaaggtgcgctgttctga

DBGET integrated database retrieval system