KEGG   Xanthomonas campestris pv. vesicatoria: XCVd0137Help
Entry
XCVd0137          CDS       T00288                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Brite
Enzymes [BR:xcv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCVd0137 (dsbC)
Secretion system [BR:xcv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XCVd0137 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pXCV183:144018..144770
Genome map
AA seq 250 aa AA seqDB search
MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKVTGVERAAVPGLLQVT
VDGSQVIYISENGQHLLAGQIIELASKDNLTERATSALHRKMLAELPPERKIVYAAEDPK
HTVTVFTDVDCGYCRMLHEHIPDYNKAGISIEYVLYPRSGLQSPTYATSVSVWCAQDRKQ
ALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAEDGRQVGGLLPPAQLLAVLD
GRAQRGPTQP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcctcgcacttccccttcttctcaccctctcgctggccgcctgcggcgacgac
tcgacgccgaacgcgagctctggccttgatttggcgcaagcagctgtcagcaagcttgcg
ccgcacgcgaaggtgaccggcgtcgaacgcgcagcagtgcccggcctgctgcaggtcacg
gtcgacggatcccaggtcatctacatctcggagaacgggcaacacctgctggccgggcag
atcattgaattggcttcgaaagacaacctgaccgagcgcgcgacaagcgccttgcacaga
aagatgctggccgagctgccgccggagcgcaagatcgtttacgcggccgaggatcccaag
cacaccgtgaccgtgttcacggacgttgactgcggatactgccggatgctccacgagcac
atccccgactacaacaaggccggcatcagcatcgagtacgtgctgtatccacgcagcggc
ctgcaatcaccgacgtatgcaacctccgtcagcgtctggtgcgcgcaggatcgcaagcag
gccctcatcgcggtctcaaccgggggcgaacttacgccagcgcaatgcaccaatcccgtg
gccgaggactatgcccttggacaacgcttgggtgtgacggcgacgccggccatcttcgcc
gaggacggccgtcaggtcggcggcctcttgccgccggcgcagctgctggccgtactcgac
ggccgggcccagcgaggtccgacacagccatga

DBGET integrated database retrieval system