KEGG   Xylella fastidiosa 9a5c: XF0091Help
Entry
XF0091            CDS       T00033                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91047..91943)
Genome map
AA seq 298 aa AA seqDB search
MFDTIPTLHCAGRTLRLDRPLVMGILNVTPDSFSDGGLHDSVDAAVAHGLRLIAEGADII
DIGGESTRPGAAPVPLEEELLRVVPVIKALTAYDKAVISVDTFKPEVMRAAVAAGAGLIN
DIYALRTPGALGAAAELAVPVILMHMKGEPHSTQTPQYDHVVDEVHRFLAERIFAAEIAG
IERHRLLIDPGFSFSKTTEHNIALLAALERFTNLGIPLLAGLSRKSSLGELTGRQLPIER
VYASVAAHLIAVQRGALIVRVHDVAAMVDALKVWQAVSAAAAPATHTKTTVARSPHDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacactatcccaaccctgcactgcgccggacgcaccttgcgtctagaccgtcca
ttggtcatgggtatcctcaacgttactcctgattctttttccgacggaggcctgcatgat
tctgtggatgcagcagtggcgcatggattacgtctgattgctgagggtgcagacatcatt
gatattggcggggaatccacccgtcccggtgcagcgccggtaccgctggaggaggaacta
ctccgagtggtgccggtcatcaaggcattaactgcctacgataaagctgtcatcagcgta
gacaccttcaaacctgaggtaatgcgtgcggcagtcgcggccggtgccggcttgatcaac
gacatctatgcactacgcactcccggagcgctgggagcagcagcagaactggctgtacca
gtgatattgatgcatatgaaaggtgaaccgcactcaacgcaaacaccacagtatgatcat
gtggttgatgaagtccaccgtttcctggccgagcggatttttgccgccgagatagcaggt
atcgaacgacaccgactgctgatcgatcctggtttcagtttcagcaagaccacggaacat
aacattgcactgttagcggcattggagcgtttcaccaatctcggcatcccattgttggcc
ggattgtcacgcaagagtagcttgggcgaactgacaggacgtcagttaccaatcgaacgc
gtgtacgcctccgtcgctgcacatctcattgcggtacaacgcggcgcgttaatcgtacgg
gtgcatgatgtggcggctatggtcgatgccctcaaagtttggcaggcagtttcagcagcg
gctgcacctgcaacacataccaaaactacagtggctcgttcgccccatgacgactga

DBGET integrated database retrieval system