KEGG   Xylella fastidiosa 9a5c: XF0116Help
Entry
XF0116            CDS       T00033                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xfa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:xfa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111713..112846
Genome map
AA seq 377 aa AA seqDB search
MSEVFDLTCDLISRPSVTPEDAGCQAMIAARLERVGFTCEHLHYGSVANLWATHGQGAPV
LVLLGHTDVVPPGPIEAWTSDPFIPQRREGKLYGRGAADMKGSVAAFVIAAERFLVAHAG
HPGTLAILLTSDEEGQAIDGVRKVAETLRQRGQGIDWCLTGEPSSSKRLGDLLRVGRRGS
LSATLHVKGVQGHVAYPHQARNPIHLAVPALAALTARHWDDGDESFPSTSLQISNIHAGT
GANNVIPGALEVAFNLRYNPHWSAPRLESEIVALLDQHGLDYTLHWHRSGEPFYTPEGKL
RRIAREVLERFSGAPPEESTGGGTSDARFIAPLGAQCIEIGPVNASIHQVDEHVCLADLE
ALPDLYQLLIERLLADH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtgtttgacctgacctgtgatctgatctccaggccttccgtgacaccagaa
gatgccggctgccaagccatgattgcagcgcgtctagagcgtgtcggcttcacctgtgaa
cacctgcattacggttccgtcgccaacctatgggccacacatggacagggtgcgccggtg
ctagtgctactgggtcacacggatgtggtccctcccggtccaattgaagcgtggacttcg
gacccgtttatcccacagcgacgcgaaggcaagctctacggacgtggcgctgcggatatg
aaaggcagtgtggctgcattcgtgattgctgccgagcgcttcttagtcgcccatgctggg
catcccggaaccttggcgatcttactgacctctgatgaagagggccaagcaatagatggt
gtccgtaaagtggccgagacgttacgccagcgtggtcagggtattgattggtgcttgact
ggtgaaccgtcttcgagcaaacgactgggtgacctgctgcgggtcggccgtcgtggcagt
ttgtcggcaacgcttcacgtgaagggcgtccagggacatgttgcctatccccatcaagca
cgcaaccccattcacctcgccgtacctgcgctcgctgcattgacggcgcggcattgggat
gacggtgatgaatccttcccgtcaaccagcttgcagatcagcaatatccacgctggaacc
ggtgccaacaacgtgattcctggtgcactggaggttgctttcaatctgcgttacaacccg
cattggagcgccccgcgcttggagagtgagattgtcgcattactcgatcaacacgggctg
gactataccttgcactggcatcgtagcggtgagccgttctataccccggaaggaaaatta
cgtcgcatcgcacgtgaagtattagagcgtttttccggcgcacctccggaagaaagcacg
ggcggcggcacgtccgatgcgcgttttattgccccactgggcgcgcaatgtattgagatt
ggaccggtcaacgccagcattcaccaggttgatgagcatgtgtgcctggccgacttggaa
gccctgccagacctgtaccagttgctaattgagcggttgcttgctgaccattga

DBGET integrated database retrieval system