KEGG   Xylella fastidiosa 9a5c: XF0151Help
Entry
XF0151            CDS       T00033                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF0151
   00030 Pentose phosphate pathway
    XF0151
   00051 Fructose and mannose metabolism
    XF0151
   00052 Galactose metabolism
    XF0151
   00500 Starch and sucrose metabolism
    XF0151
   00520 Amino sugar and nucleotide sugar metabolism
    XF0151
  Nucleotide metabolism
   00230 Purine metabolism
    XF0151
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XF0151
Enzymes [BR:xfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XF0151
    5.4.2.8  phosphomannomutase
     XF0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154644..156038
Genome map
AA seq 464 aa AA seqDB search
MVQPSLFHEDDIHGVVPGELNPGVAKLIGQAIGSAIQVKGLSDIVIGRDDRVSSFELSAA
LSDGLRHAGCNVVDIGLVPIPVVYFAACHLGVGSCVAVTGGHHPHDYNGFKIVLGGESLS
SEAMSDLYQCITNGRLYASVDSGNLSERDVVDDYIQRIADDVQLNRPLKIVADPGHGAAE
EILSRLFKAIGADLVSLYGDIDGVSLHGHPDSDELGNLQKLIQRVEQADADLGLAFDGDA
ASLRVVTREGEVILSDSVLMLFATDVLQRNPGALVIYDAECTSKLSDCVLRNGGSPLMWK
TGHASIKAKMRETGAELAGEMSGYFFFKERWYGFEDALYAAARLLEILAQREDNPSQVFA
ALPHAYFTAQMEQSVEGDAQACVQSFIEEVQRSVEGSVFDGARLFAFDGLRADFTDGWGL
VRVSDTASALVLRFEADTQAGLERIQSAFRTHLQALLPGQILVF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggttcaacccagtcttttccatgaagacgatatccacggtgtggttcctggcgagttg
aacccaggtgtggcgaagttgatcggtcaagcgatcggcagtgcgatccaggtcaaaggt
ttgagtgacattgtgattggccgtgacgaccgcgtgtccagttttgaattgtctgcggca
ttaagtgatggtctacgtcatgccggttgcaatgtggtagacatcggcttggtgccgatc
ccggtagtgtatttcgctgcctgccatcttggcgttgggagttgcgttgcggtcacaggg
gggcatcatcctcatgattacaacggtttcaagatcgtgcttggtggtgagtccttatcc
agtgaggcgatgagcgatttgtatcaatgcatcaccaatggtcgcttatatgcgtccgtt
gactccggcaatttgagtgagcgtgatgtggttgacgattacattcagcgtattgctgat
gatgtgcagttgaatcgtccgctgaagattgttgctgatcctggtcacggtgcggctgaa
gagatcctgtcacgtttattcaaggcgattggtgcggatctggtgtcactgtacggtgat
attgatggtgtttcccttcatggtcatcctgattcggacgagctagggaatctgcagaag
ctgattcagcgggttgagcaggccgatgccgatttgggtcttgcttttgatggggatgcg
gcaagtctcagagtggtgactcgagaaggtgaggttattttatcggatagcgtgttgatg
ttgtttgcgacggatgtgctacagcggaatccgggtgctttggtgatctatgatgctgaa
tgtactagcaagttgtctgattgtgtattgcgcaacggcggcagcccgttgatgtggaag
accgggcatgcctccatcaaagctaagatgcgcgagaccggtgccgagttggctggtgaa
atgagtggctatttcttcttcaaagaacgctggtatggttttgaggatgctctgtatgcg
gcggcgcgtttgctggagatcttagcgcagcgcgaagataatccgtcccaggtgtttgct
gcactgccccatgcttatttcactgcccaaatggagcagtctgtcgagggtgatgcgcag
gcatgtgtacagtcctttattgaggaagtgcagcgtagcgttgagggcagtgtgttcgat
ggtgctcgtttgttcgcctttgatggtttgcgtgctgatttcactgatggttgggggcta
gtacgcgtttctgacactgcatctgcactggtgttgcgttttgaggctgacacgcaggct
ggattggagcggattcagagtgcattccgcacgcatttacaggcattactacccggtcag
atactggtgttctaa

DBGET integrated database retrieval system