KEGG   Xylella fastidiosa 9a5c: XF0214Help
Entry
XF0214            CDS       T00033                                 

Definition
hypothetical protein
Organism
xfa  Xylella fastidiosa 9a5c
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221759..222481
Genome map
AA seq 240 aa AA seqDB search
MSALSPSLREDAPLVVFDFDHTLYDGDSGSDLFAWLMLRNPLRLLLALLVTPLLGPLVAM
LATRRRSLSCYVWIATFGMRYTHEFNKVIRAYVRGHASRIRKRLLPKALEVFASHRIAGD
CVVVATGAPSELVREILALVADQEEVVPVIGSSIVPRLGAIIVVRHCHHEEKMRMLREQG
YGDVAVAYSDSTADLPLLMAAKVPVVVNPKPKREKLFRRVLPPGTSIIHWGCPRRGGACD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcattatctccatcattgcgcgaggatgcgccattagttgtctttgatttcgat
catacgttgtacgatggcgattctggcagtgatttgttcgcttggctgatgctgcgcaat
ccgctgcgcttgcttttagcacttctagtgacgcctttactgggcccgttggtcgcaatg
ctggcgacgcggcgccgtagtctttcctgttacgtttggattgctacctttggcatgcgc
tatacgcatgagttcaataaggtcatcagggcttatgtgcgaggacatgcgtcgcggatc
cgcaagcgcttattaccgaaggcgttggaagtatttgcgtcccatcgcattgctggagat
tgtgtggtggtggccactggtgctccctctgaactggtacgcgaaatcctggctttggtg
gctgatcaggaggaggtggtgcctgtgattggcagttctatcgtgccgcgtttgggggca
atcattgttgttcgtcattgccaccatgaggaaaaaatgcggatgctccgtgaacagggc
tatggtgatgttgctgtggcgtattctgatagtactgcagatttaccgttacttatggca
gcaaaggtacccgtggtggtgaatcccaagcccaagcgtgaaaaattgttccgtagggtg
ttgccgccgggtacatcaatcattcactggggatgtcctcgccgtggaggcgcttgcgat
tag

DBGET integrated database retrieval system