KEGG   Xylella fastidiosa 9a5c: XF0214Help
Entry
XF0214            CDS       T00033                                 

Definition
hypothetical protein
Orthology
K18697  
phosphatidylglycerophosphatase C [EC:3.1.3.27]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XF0214
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.27  phosphatidylglycerophosphatase
     XF0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221759..222481
Genome map
AA seq 240 aa AA seqDB search
MSALSPSLREDAPLVVFDFDHTLYDGDSGSDLFAWLMLRNPLRLLLALLVTPLLGPLVAM
LATRRRSLSCYVWIATFGMRYTHEFNKVIRAYVRGHASRIRKRLLPKALEVFASHRIAGD
CVVVATGAPSELVREILALVADQEEVVPVIGSSIVPRLGAIIVVRHCHHEEKMRMLREQG
YGDVAVAYSDSTADLPLLMAAKVPVVVNPKPKREKLFRRVLPPGTSIIHWGCPRRGGACD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcattatctccatcattgcgcgaggatgcgccattagttgtctttgatttcgat
catacgttgtacgatggcgattctggcagtgatttgttcgcttggctgatgctgcgcaat
ccgctgcgcttgcttttagcacttctagtgacgcctttactgggcccgttggtcgcaatg
ctggcgacgcggcgccgtagtctttcctgttacgtttggattgctacctttggcatgcgc
tatacgcatgagttcaataaggtcatcagggcttatgtgcgaggacatgcgtcgcggatc
cgcaagcgcttattaccgaaggcgttggaagtatttgcgtcccatcgcattgctggagat
tgtgtggtggtggccactggtgctccctctgaactggtacgcgaaatcctggctttggtg
gctgatcaggaggaggtggtgcctgtgattggcagttctatcgtgccgcgtttgggggca
atcattgttgttcgtcattgccaccatgaggaaaaaatgcggatgctccgtgaacagggc
tatggtgatgttgctgtggcgtattctgatagtactgcagatttaccgttacttatggca
gcaaaggtacccgtggtggtgaatcccaagcccaagcgtgaaaaattgttccgtagggtg
ttgccgccgggtacatcaatcattcactggggatgtcctcgccgtggaggcgcttgcgat
tag

DBGET integrated database retrieval system