KEGG   Xylella fastidiosa 9a5c: XF0259Help
Entry
XF0259            CDS       T00033                                 

Definition
phosphomannose isomerase-GDP-mannose pyrophosphorylase
Orthology
K16011  
mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xfa00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xfa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(270540..271988)
Genome map
AA seq 482 aa AA seqDB search
MLPTSHTPCMESAPPMNDILPVILSGGSGTRLWPLSREAYPKQFLPLVGHHSMLQATWLR
AAPVTTHSPIVVANEEHRFIAAEQLQHLGVYPSAILLEPTGRNTAPAIAVAALEATRTGN
DPLLLVLPSDHVIRDEAAFQTAVHVAAEAAAQGKLVTFGITPNTPEIGYGYIKATGNDTI
RPVERFIEKPDLATAQSYLASGDYFWNSGMFLFRASRYLAELSTFQPAIAEACQRAWSAA
KRDTDFIRLDKEAFENSPADSIDYAVMEHTADAVAVPLDAGWNDVGSWSALHEVSKQDND
GNAHQGDVIQIDCRNTYAYGSRLIAMVGLENVVVVETDDALLVGHRDSIQTVKEIVGKIK
ANGRPEATWHRKVYRPWGAYDSIDTGQRFQVKRITVKPGGTLSLQMHHHRAEHWIIVSGT
AEVTRGSEILLLTENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIVRFEDTYG
RT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgcttcccacctcacacaccccctgcatggagtcagccccgcctatgaacgatatcctt
cccgtgatcctatccggcggttctggcacccggctatggccactatcgcgcgaagcctat
cccaaacagtttctgccactggttggccaccacagcatgctgcaagccacgtggctacgc
gccgctcccgtgacaacgcattcacccatcgtcgttgccaacgaagaacaccgctttatt
gccgcagaacaattgcagcatttgggcgtgtatccctcagcgattctgcttgaacccaca
ggccgcaacaccgccccggcgatcgccgtggccgcactggaagcaacacggaccggcaac
gatccactactcctcgtcctaccgtccgaccacgtcatccgtgacgaagcagcgttccaa
actgccgtccatgtggccgccgaagccgccgcccaagggaaattggtcacctttggcatc
accccaaacaccccggaaattggctacggctacatcaaagccaccggcaacgacacgata
cgtcccgtcgagcgcttcatcgaaaaacccgatctggccaccgctcaaagctatctggcc
tccggcgactatttttggaatagcggcatgttcctattccgcgcctcacgctacctagcc
gaactcagcacctttcaaccagcaatcgccgaagcctgccaacgggcatggagcgcagca
aagcgcgataccgacttcatccgattagataaagaagcattcgaaaacagcccagcggat
tctatcgattacgcagtcatggaacacaccgccgacgccgtcgccgtgccactagacgcc
ggctggaacgatgtcggctcctggtcggccctacatgaagtctccaaacaagataacgac
ggcaatgcccaccagggcgatgtgatccaaatcgactgccgcaacacctacgcctatgga
tcgcgtctgatcgcaatggttggactggaaaacgtggtggtcgtagaaactgatgacgcc
ttattagtcggccatcgtgacagcatccagaccgtcaaagagatcgttggcaaaatcaaa
gcaaacggacgtcccgaagccacctggcaccgcaaagtctaccgtccgtggggggcatac
gactccatcgacaccggccaacgcttccaagtcaagcgcatcaccgtcaagcccggcggc
acactgagcctacaaatgcaccatcaccgcgccgaacactggatcatagtcagcggcacc
gccgaagtcacacgcggcagcgaaatcctattactaaccgaaaatcagagcacgtacatc
ccgctcggcgtgacccaccgcctacgtaacccagggaaactgccactcgaattgatcgaa
gtacagtcgggcagctatctcggcgaagatgacatcgtacgttttgaagatacgtatggt
cgtacttga

DBGET integrated database retrieval system