KEGG   Xylella fastidiosa 9a5c: XF0274Help
Entry
XF0274            CDS       T00033                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF0274
   01230 Biosynthesis of amino acids
    XF0274
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF0274
   00030 Pentose phosphate pathway
    XF0274
   00051 Fructose and mannose metabolism
    XF0274
   00052 Galactose metabolism
    XF0274
  Energy metabolism
   00680 Methane metabolism
    XF0274
Enzymes [BR:xfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XF0274
Protein phosphatases and associated proteins [BR:xfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XF0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(284260..285543)
Genome map
AA seq 427 aa AA seqDB search
MSSPYKSSSHMAKETLLYAQSGGVTAVINATAAAVITEARSHRVKVLAARNGILGALRED
LIDTSKESITAIRALTHTPGGAFGSCRFKLKSLEADHDKYERLLEVFKAHNVRWFLYNGG
NDSADTALKVSQLAKTFDYPLHCIGVPKTIDNDLAITDASPGFGSAAKYTAVSICEAALD
VAAMAETSTKVFIYEAMGRHAGWLAAAAGLAGQGQEEAPHIILLPERTYDETAFLAKVQQ
VVDGVGWCVVVASEGIRSNDGRFVADAGGTTDAFGHTQLGGVAAYLASRVKQTLGLKVHW
TLPDYLQRSARHIASKTDWEQAQAVGKAAVRYALEGMNAVMPVIVRTSDTPYRWKIEPAA
LTKIANHEKTLPASFLRRDGFGISERARTYFEPLIRGETPMPYERNGLPRHVHLKNQSVP
KQLPAWE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgccctacaagagctcgtcccacatggcaaaagagacgttgttatacgcccaa
tccggcggcgttaccgctgttatcaacgcaaccgccgccgcggtcatcaccgaagcacgg
tcacaccgcgttaaagtcctcgccgcacgcaatggcatcctcggtgcactgcgtgaagac
ctgatcgacacatccaaagaatcaatcacggcaatccgtgccttgacccataccccagga
ggtgcatttggctcgtgccgtttcaagctcaaatcgcttgaagccgatcacgacaagtac
gaacggttacttgaagtattcaaagcacataacgtgcgctggttcctctacaacggtggt
aatgactccgccgataccgcgctcaaagtctcacagttagccaaaacatttgactatcca
ctgcactgtatcggcgtccctaaaaccatcgacaacgatttggcgatcaccgacgccagc
cccggcttcggttcagccgcaaagtacactgctgtctccatatgcgaagccgcgctggat
gtggcagcgatggccgagacctcaaccaaggttttcatttacgaagcaatgggccgccat
gccggttggctcgctgcagctgctggcttggccggccaagggcaggaagaagccccccac
atcatcctgctccctgaacgtacctacgacgaaacagcatttctggcgaaagtccaacag
gtagtcgacggagtcggttggtgcgtggtggtcgccagcgaaggcatccgcagcaatgat
gggcgcttcgttgccgatgctggcggcaccaccgatgcctttggtcacacgcaacttggc
ggcgtcgccgcttacctcgccagccgagtgaaacagacactcggactcaaagtgcactgg
acgctgccagattacctacaacgctccgcaaggcacatcgcctccaaaacagactgggaa
caagcacaggctgtgggtaaagctgcagtacgctacgcactggaaggcatgaatgcagtc
atgcctgtcatcgtacgcacctctgacaccccataccgttggaaaatcgagccggcagca
ctcaccaagattgccaaccacgaaaaaaccttaccagcaagctttttacgccgtgacggc
ttcggcatcagcgaacgtgcacgcacctactttgaaccattgattcgtggcgaaacaccc
atgccctacgaacgcaacggattaccgcgacacgtccatctaaaaaatcaaagcgtaccg
aaacagctacctgcctgggaataa

DBGET integrated database retrieval system